Details for Arabidopsis Locus AT3G09830

Position : Chr3 ( 5`- 3016494 .. 3018983 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09830

Protein [Map View]
MKCFLFSGGDKRGEQKTPISVSLTSIFSDREINRSGSEFNSRDVSGTSTESSMGRKNSYPPVSTRASNLREFSITDLKSA
TKNFSRSVMIGEGGFGCVFRGTVRNLEDSSVKIEVAVKQLGKRGLQGHKEWVTEVNFLGIVEHTNLVKLLGYCAEDDERG
IQRLLVYEYMPNRSVEFHLSPRSLTVLTWDLRLRIAQDAARGLTYLHEEMEFQIIFRDFKSSNILLDEDWKAKLSDFGLA
RLGPSEGLTHVSTDVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFLYELITGRRPVDRNRPKGEQKLLEWVRPYLSDTRKF
KLILDPRLEGKYPIKSVQKLAVVANRCLVRNSKARPKMSEVLEMVNKIVEASSGNGSPQLVPLNSVKASRDARGKNNGGG
GEGGWFGKLWNPKTIRAC*

DNA
ATGAAGTGTTTCTTGTTCTCTGGTGGGGATAAGAGAGGGGAACAGAAGACCCCTATTTCGGTTTCATTGACCTCTATCTT
CTCTGACCGCGAAATAAACCGAAGCGGGTCAGAGTTCAACTCTCGTGATGTCTCTGGGACGAGCACAGAATCATCCATGG
GGAGGAAGAACTCGTACCCTCCGGTGTCTACTAGAGCAAGTAATCTCAGAGAGTTCAGCATTACTGATCTCAAGTCTGCA
ACAAAGAACTTTAGCCGATCTGTTATGATTGGAGAAGGCGGTTTCGGTTGTGTCTTCAGGGGCACAGTGAGGAACTTAGA
GGACTCGTCAGTTAAAATCGAAGTCGCAGTGAAGCAGCTCGGTAAAAGAGGGTTGCAGGGGCATAAGGAATGGGTTACGG
AAGTGAACTTCCTCGGAATAGTTGAGCATACAAACTTGGTGAAATTGCTTGGCTATTGTGCAGAAGATGATGAACGTGGA
ATCCAACGGCTTTTGGTTTATGAATACATGCCTAACCGAAGTGTTGAATTCCACTTATCCCCTCGGTCACTCACAGTTCT
TACTTGGGACCTCAGACTGAGAATCGCCCAAGATGCAGCTCGCGGATTAACATACCTGCATGAAGAAATGGAGTTTCAGA
TAATATTCCGCGATTTCAAGTCCTCGAACATTCTTTTGGATGAGGACTGGAAAGCAAAGCTCTCAGATTTCGGTTTGGCT
CGTTTAGGTCCATCTGAAGGATTAACCCATGTTTCTACTGATGTTGTAGGTACAATGGGTTATGCAGCACCTGAATACAT
TCAAACCGGCCGTCTCACATCGAAAAGCGATGTGTGGGGTTATGGAGTCTTCCTCTATGAGCTTATCACTGGGAGGCGAC
CGGTGGACAGAAACAGACCCAAGGGAGAGCAGAAGCTTCTAGAATGGGTGAGACCTTATTTATCTGACACAAGGAAGTTC
AAGCTCATATTAGATCCAAGGCTGGAAGGGAAGTACCCGATCAAATCGGTTCAAAAGCTAGCAGTTGTGGCCAACAGATG
TTTGGTTAGGAACTCAAAGGCACGTCCCAAGATGAGTGAGGTTTTAGAGATGGTGAACAAAATTGTGGAAGCTTCTTCAG
GAAATGGCAGCCCACAGCTAGTTCCGCTGAACAGTGTAAAAGCTTCGAGAGACGCGAGAGGAAAGAACAATGGTGGTGGC
GGTGAAGGAGGTTGGTTTGGCAAGTTATGGAATCCAAAGACAATAAGAGCTTGTTGA