Details for Arabidopsis Locus AT3G09820

Position : Chr3 ( 5`- 3011990 .. 3014944 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09820

Protein [Map View]
MASSDFDGILLGMGNPLLDVSAVVDQQFLDKYDIKLNNAILAEDKHLPMYDEMSQKFNVEYIAGGATQNSIKVAQWMLQV
PGATSYMGSIGKDKYGEAMKKDATAAGVYVHYYEDEATPTGTCGVCVLGGERSLIANLSAANCYKVEHLKKPENWALVEK
AKFYYIAGFFLTVSPESIQLVREHAAANNKVFTMNLSAPFICEFFKDVQEKCLPYMDYIFGNETEARTFSRVHGWETDDV
EQIAIKMSQLPKASGTYKRTTVITQGADPVVVAEDGKVKKYPVIPLPKEKLVDTNGAGDAFVGGFLSQLVHGKGIEECVR
AGCYASNVVIQRSGCTYPEKPDFN*

DNA
ATGGCTTCCTCTGATTTCGATGGAATCCTTTTGGGAATGGGAAACCCACTCCTCGACGTCTCTGCCGTCGTCGACCAACA
GTTTCTCGACAAATACGACATCAAATTGAACAATGCGATTCTCGCAGAGGACAAACATTTGCCCATGTACGATGAAATGA
GCCAGAAGTTCAATGTTGAATACATTGCTGGAGGTGCTACCCAGAACTCAATCAAAGTGGCCCAGTGGATGCTTCAAGTT
CCTGGGGCAACCAGTTACATGGGATCCATTGGAAAGGACAAATACGGAGAGGCAATGAAGAAGGATGCTACAGCAGCTGG
TGTCTATGTCCACTATTACGAAGATGAGGCAACACCTACCGGAACTTGCGGTGTCTGTGTTCTTGGTGGAGAAAGATCGC
TCATTGCCAATCTTTCTGCTGCTAATTGCTACAAGGTTGAACACTTGAAGAAGCCTGAGAACTGGGCTCTGGTTGAGAAG
GCCAAGTTTTATTACATTGCTGGATTCTTCCTCACGGTATCACCAGAATCCATTCAGTTGGTACGTGAACATGCTGCTGC
AAACAACAAGGTGTTCACGATGAACCTTTCTGCTCCATTCATCTGTGAATTCTTCAAAGATGTTCAGGAGAAGTGCCTGC
CGTACATGGACTATATTTTTGGCAATGAGACCGAGGCAAGAACCTTCTCCAGGGTTCACGGCTGGGAGACTGATGATGTT
GAGCAAATAGCCATCAAGATGTCCCAGTTACCCAAAGCCTCTGGAACATACAAGAGGACTACTGTGATTACACAAGGCGC
AGATCCTGTGGTTGTCGCTGAGGATGGAAAAGTGAAGAAGTACCCAGTCATCCCTCTCCCCAAAGAGAAGCTTGTTGACA
CCAACGGTGCAGGTGATGCATTTGTGGGAGGGTTTCTGTCCCAGCTGGTGCACGGAAAGGGGATTGAAGAGTGTGTGAGG
GCAGGATGCTACGCGTCAAACGTAGTGATCCAGAGGTCTGGTTGCACTTACCCTGAGAAACCAGACTTCAACTAA