Details for Arabidopsis Locus AT3G09810

Position : Chr3 ( 5`- 3008694 .. 3011437 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09810

Protein [Map View]
MTMTAFLARRLIGNGSSQILGTSSSSSGPFISVSRAFFSSSTPIKATLFPGDGIGPEIAESVKQVFTAADVVIDWDEQFV
GTEVDPRTNSFLTWDNLQSVLKNKVGLKGPMATPIGKGHRSLNLTLRKELNLYANVRPCYSLPGYKTRYDDVDLITIREN
TEGEYSGLEHQVVKGVVESLKIITRKASMRVAEYAFLYAKTHGRKKVSAIHKANIMQKTDGLFLQCCDEVAAKYPEIYYE
KVVIDNCCMMLVKNPALFDVLVMPNLYGDIISDLCAGLVGGLGLTPSMNIGEDGIALAEAVHGSAPDIAGMNLANPTALL
LSGVMMLRHLKLNKQAEQIHSAIINTIAEGKYRTADLGGSSTTTDFTKAICDHL*

DNA
ATGACCATGACAGCATTTCTCGCGAGACGGCTTATCGGTAACGGATCGAGCCAGATTCTCGGGACTTCGAGTTCTAGCTC
CGGTCCGTTCATTTCCGTTTCTAGGGCTTTCTTCTCCTCCTCCACTCCGATCAAAGCTACTCTCTTTCCCGGTGATGGGA
TCGGTCCCGAAATCGCTGAATCTGTCAAGCAGGTGTTTACTGCCGCTGATGTGGTTATTGATTGGGACGAACAGTTTGTT
GGTACTGAAGTAGATCCTAGAACCAATAGTTTCTTGACATGGGATAATCTTCAATCTGTGCTTAAAAACAAGGTTGGTTT
GAAAGGACCAATGGCTACTCCAATTGGAAAGGGTCACCGTTCCTTGAACCTTACTCTTAGGAAAGAGCTGAATTTGTATG
CCAATGTTAGGCCTTGTTACAGTCTTCCTGGTTACAAAACCCGTTATGATGATGTTGATCTCATTACCATTCGTGAGAAC
ACTGAAGGAGAGTACAGTGGGCTTGAACACCAGGTCGTCAAGGGTGTAGTGGAAAGTCTTAAAATTATTACCCGTAAGGC
GAGTATGAGAGTTGCCGAGTATGCCTTTCTTTATGCCAAGACTCACGGAAGGAAGAAAGTTTCTGCAATTCACAAAGCCA
ACATTATGCAGAAAACTGATGGTCTTTTCCTGCAGTGTTGTGATGAAGTTGCTGCGAAGTATCCTGAGATATATTACGAG
AAGGTTGTTATTGACAATTGCTGTATGATGCTTGTGAAAAACCCAGCACTTTTTGATGTCTTGGTGATGCCAAATCTCTA
TGGAGATATTATCAGCGATTTGTGTGCTGGACTTGTTGGGGGACTAGGACTGACTCCTAGTATGAATATTGGGGAGGATG
GTATTGCCCTTGCTGAAGCTGTTCACGGCTCTGCACCTGATATTGCTGGAATGAACCTGGCGAACCCAACAGCTTTGCTA
CTGAGTGGAGTGATGATGTTGCGGCACCTGAAGCTCAACAAACAAGCAGAGCAAATCCACAGTGCCATCATCAACACAAT
AGCCGAGGGAAAGTATAGAACTGCTGATCTCGGAGGTTCCTCAACTACAACAGATTTCACAAAAGCCATCTGTGATCATC
TCTAA