Details for Arabidopsis Locus AT3G09800

Position : Chr3 ( 5`- 3006515 .. 3008489 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09800

Protein [Map View]
MSPDSCPLVKKILLLDSEGKRVAVKYYSDDWPTNAAKLSFEKYVFSKTSKTNARTEAEITLLDSNIIVYKFAQDLHFFVT
GGENENELILASVLQGFFDAVALLLRSNVEKMEALENLDLIFLCLDEMVDQGVVLETDPNVIAGKVAMQSTEASGSLSEQ
TLTQALATAREHLARSLLT*

DNA
ATGTCTCCTGATTCTTGTCCTTTGGTAAAGAAGATTCTTCTTCTAGACTCTGAAGGAAAGCGTGTGGCTGTCAAGTATTA
CTCGGATGACTGGCCAACTAATGCCGCCAAGTTAAGTTTTGAGAAGTATGTATTCTCAAAGACCTCTAAGACCAATGCTC
GTACAGAAGCTGAGATCACACTGTTGGACAGCAATATTATTGTCTATAAGTTTGCCCAGGACCTTCACTTCTTTGTTACT
GGAGGTGAAAATGAAAACGAGCTCATCTTAGCTTCTGTTCTTCAAGGCTTTTTTGATGCTGTTGCACTTCTTCTGAGGAG
CAATGTGGAAAAGATGGAAGCCCTTGAGAACTTGGATCTCATCTTTCTATGCCTTGATGAAATGGTCGATCAAGGGGTGG
TTCTTGAAACGGATCCAAACGTCATTGCGGGGAAAGTAGCAATGCAGAGCACAGAAGCTAGTGGTTCACTCTCTGAACAG
ACACTAACACAAGCGCTAGCAACAGCTCGGGAGCATCTGGCAAGAAGTCTGCTTACATGA