Details for Arabidopsis Locus AT3G09780

Position : Chr3 ( 5`- 3000759 .. 3003179 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09780

Protein [Map View]
METRCSLLFLSLILLYLPKPGSGFGSSGPIAASFGGSAFFCAIDASGRQDVICWGKNYSSPSSPSSSSSSSSIASSTSAS
YNIPSMAVLSGGDGFLCGILSNTSQAFCFSSLGSSSGMDLVPLAYRTTAYSQIAAGNSHVCAVRGAYYSDHDSGTIDCWE
ITRATNNNSLIAKENPNFYDQIVSNLVFNNIVSGDGFSCGGIRDGGMLCFGPNSSNLGFNTTSDNFQVLAAGKNSVCAIL
NLSREVKCWGEDESFVNSPMNDSRFVSLTAGPRHFCGIREDNHEVECWGNSNFSLIPKGSGFKAIASSDFIVCGIREEDL
VLDCWMVNGSSTLAYDPPLELCSPGMCRAGPCNEKEFAFNASILNEPDLTSLCVRKELMVCSPCGSDCSHGFFLSSSCTA
NSDRICTPCSLCQNSSCSDICKLHNSNFPDKHWHQLQRLVLIIGSCASALLIIIIGCCVVPRIVTSPNKEDGAANQFKSC
IGKPDLDTDQPLENVSPAPSVTPFAQVFRLSELKDATNGFKEFNELGRGSYGFVYKAVLADGRQVAVKRANAATIIHTNT
REFETELEILCNIRHCNIVNLLGYSTEMGERLLVYEYMPHGTLHDHLHSGFSPLSWSLRIKIAMQTAKGLEYLHNEAEPR
IIHGDVKSSNVLLDSEWVARVADFGLVTSSNEKNLDIKRDVYDFGVVLLEILTGRKRYDRDCDPPEIVEWTVPVIREGKA
AAIVDTYIALPRNVEPLLKLADVAELCVREDPNQQPTMSELANWLEHVARDALIF*

DNA
ATGGAAACCCGTTGCTCTCTCCTCTTTCTCTCTCTCATTCTCCTGTATTTGCCCAAACCCGGATCCGGATTTGGATCCTC
CGGTCCGATTGCGGCGTCGTTCGGCGGCTCTGCTTTCTTCTGCGCCATTGACGCTAGTGGTCGTCAAGATGTTATCTGCT
GGGGAAAGAACTATTCATCTCCTTCTTCTCCCTCTTCTTCTTCTTCTTCGTCGTCTATTGCTTCTTCCACTTCCGCAAGC
TACAACATTCCGTCAATGGCGGTTCTTTCAGGCGGAGACGGGTTTCTCTGCGGCATTTTGTCGAACACTTCTCAAGCATT
CTGTTTTAGTTCACTTGGGTCTTCTTCAGGTATGGATCTTGTCCCTCTAGCTTACAGGACTACTGCTTACTCTCAGATAG
CTGCTGGAAACAGCCATGTCTGTGCTGTTAGAGGAGCTTACTATTCCGATCACGATTCTGGGACTATCGATTGTTGGGAG
ATAACTAGAGCTACGAACAACAACAGCTTAATCGCCAAGGAGAATCCTAACTTCTATGATCAGATTGTTAGTAATCTCGT
CTTCAACAATATTGTTTCTGGTGATGGGTTTAGCTGTGGTGGAATCAGAGATGGTGGGATGCTCTGTTTTGGTCCCAATT
CTTCTAATTTAGGGTTTAACACAACTTCTGATAACTTCCAAGTCTTAGCCGCCGGTAAAAACTCCGTTTGTGCTATTCTT
AATTTATCTCGAGAGGTTAAATGTTGGGGAGAAGATGAATCTTTTGTCAATTCTCCGATGAATGATTCTCGATTCGTCTC
GCTAACCGCGGGTCCTCGCCATTTCTGCGGAATCCGTGAGGATAATCATGAGGTTGAGTGTTGGGGAAACTCTAATTTCT
CTTTGATTCCAAAAGGTTCTGGATTTAAAGCAATAGCTTCGTCTGATTTCATTGTTTGTGGTATTAGAGAAGAGGATCTT
GTTCTTGATTGTTGGATGGTTAATGGTTCGTCCACATTAGCTTACGATCCTCCGTTAGAGCTCTGCAGTCCAGGGATGTG
TAGAGCTGGTCCTTGTAATGAAAAAGAGTTTGCTTTCAACGCAAGTATACTCAATGAACCTGACCTAACGAGTTTGTGTG
TAAGGAAAGAGTTAATGGTCTGTTCACCTTGCGGCTCGGATTGCTCTCACGGATTCTTCTTGTCAAGTTCGTGCACCGCG
AACTCTGATCGGATATGTACGCCTTGCTCGCTCTGTCAAAACAGTTCTTGTTCGGATATATGTAAGCTTCATAACAGCAA
TTTTCCAGATAAGCATTGGCATCAACTACAGAGACTTGTTCTTATCATCGGGTCTTGCGCATCCGCTCTATTGATCATTA
TAATTGGTTGCTGTGTTGTGCCACGGATTGTCACTAGTCCTAATAAAGAAGACGGAGCAGCGAATCAATTCAAATCTTGC
ATAGGAAAGCCCGATTTAGACACTGATCAGCCACTTGAAAATGTATCCCCTGCTCCATCGGTAACGCCTTTTGCTCAAGT
GTTTAGACTCTCTGAGCTTAAAGACGCGACCAACGGGTTTAAAGAGTTCAATGAGTTAGGCAGAGGAAGCTATGGGTTTG
TCTACAAAGCCGTGTTGGCGGACGGGAGGCAAGTAGCGGTTAAGAGAGCAAACGCAGCAACCATAATCCACACAAACACT
AGAGAATTCGAGACAGAATTGGAGATTCTCTGCAACATTAGGCATTGCAACATTGTGAATCTCCTTGGTTACTCTACCGA
AATGGGAGAGAGGCTTCTTGTTTACGAGTACATGCCTCACGGTACGCTTCACGATCATCTGCACAGTGGGTTTTCGCCAT
TGAGTTGGAGCTTAAGGATCAAAATCGCTATGCAAACCGCAAAGGGTCTTGAGTATCTTCACAATGAAGCTGAGCCGAGA
ATCATTCATGGCGATGTGAAGTCTTCGAATGTACTATTGGACTCGGAATGGGTGGCGAGAGTTGCGGATTTCGGGCTCGT
GACATCGTCGAACGAGAAGAATTTGGACATCAAAAGAGATGTTTATGACTTTGGAGTTGTGCTGTTAGAGATTTTAACCG
GTAGGAAACGTTATGATAGGGACTGTGATCCGCCGGAGATTGTTGAATGGACGGTTCCGGTGATCAGAGAAGGCAAAGCG
GCGGCGATTGTGGATACGTATATTGCGTTGCCGAGAAACGTGGAGCCGTTGTTGAAACTTGCTGACGTGGCAGAGTTGTG
TGTACGGGAGGATCCGAATCAACAACCAACTATGTCGGAACTTGCGAATTGGTTGGAACATGTCGCAAGAGATGCATTGA
TCTTCTAG