Details for Arabidopsis Locus AT3G09760

Position : Chr3 ( 5`- 2992654 .. 2995634 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09760

Protein [Map View]
MMDDKARKEEEHHVSHQHNHSPLQRDGNSAEIAQGQELSSPGRDLWRRGLVLDLPSTTPEDTTRDDLFRRNASLTSSPVA
KRVNFSPMSSPRVGQRGASLSPSSSTSSSSRNKPNSLKNLIPKLSFKNRNSNNDNVDIEKAADLGFVSSPSSGNGRDRST
WTLTNILTPRLKKTESLPVTPIAHSNPESTHGRFAVDLVTSTKKGPPLPIHRSRSVPAFNKDGSQRQLGVFRVIPTPNMS
PTRNTIKLNDANVDGAEDVPEEEAVCRICLVELGEDSEAFKMECLCRGELALAHKECTIKWFTIKGNRTCDVCKQEVQNL
PVTLLRMQNSRGSIGAPDAEAAHYSLWQDVPILVIVSMLAYFCFLEQLLLTKMQSGAIAVSLPFSCVLGLFASMTATTMV
PKRYVWIYATTQFGLVVFFSHIFFTLVRMQPVVAILLATIVGFGLTMSGTTGIVEFSKWRRSNRTAELPSSSQVDQPLVE
TTDQNISGSRN*

DNA
ATGATGGATGATAAAGCTCGCAAAGAAGAAGAACATCATGTGTCTCACCAACATAATCATTCTCCTCTGCAAAGGGATGG
AAATTCTGCTGAGATTGCACAAGGACAAGAGCTATCATCACCGGGCCGAGACCTATGGAGGCGAGGTCTTGTGTTAGATT
TACCATCAACAACACCTGAAGATACTACAAGAGATGATCTTTTTAGACGAAATGCATCTTTAACTTCAAGTCCTGTTGCC
AAAAGAGTCAACTTTTCTCCAATGTCCAGCCCTAGAGTCGGACAACGTGGTGCATCCTTGAGTCCTTCTTCTTCTACTTC
TTCTTCTTCAAGAAACAAACCTAATAGCCTGAAGAATCTAATCCCCAAGTTAAGCTTTAAGAACCGGAACAGCAATAACG
ATAATGTGGATATCGAGAAAGCCGCGGATTTGGGCTTTGTGTCCTCCCCTTCTTCAGGAAATGGCAGGGACAGGTCTACA
TGGACTCTCACTAATATTTTAACTCCAAGATTGAAGAAAACTGAGTCTCTTCCTGTAACCCCTATAGCTCACTCAAATCC
TGAGTCCACTCACGGGAGATTTGCCGTTGATCTAGTTACTTCCACGAAAAAAGGGCCTCCACTGCCTATCCACCGTTCAC
GCTCTGTCCCAGCATTCAACAAAGATGGAAGTCAAAGGCAATTAGGTGTTTTCCGGGTGATTCCAACTCCAAACATGTCT
CCAACCAGAAATACTATTAAACTTAACGACGCGAATGTTGATGGAGCTGAAGATGTTCCTGAAGAAGAAGCTGTGTGTAG
AATCTGCCTTGTAGAATTGGGAGAAGATTCAGAAGCCTTCAAGATGGAATGTTTGTGTAGAGGGGAACTAGCTCTTGCCC
ACAAAGAATGTACAATCAAATGGTTCACCATTAAAGGAAACAGAACATGTGATGTGTGCAAGCAAGAGGTTCAGAATCTC
CCTGTGACCCTTCTTCGCATGCAGAATTCTCGGGGTAGTATTGGAGCTCCAGACGCCGAGGCTGCACACTACAGTTTATG
GCAGGATGTTCCAATTCTTGTGATTGTAAGCATGCTTGCATACTTCTGTTTTCTCGAGCAGCTTCTGCTTACAAAAATGC
AATCTGGCGCCATTGCAGTTTCTTTACCATTCTCGTGCGTTCTTGGTCTTTTTGCTTCGATGACGGCAACAACAATGGTG
CCGAAGAGATATGTCTGGATTTACGCTACAACTCAGTTCGGTCTTGTTGTTTTTTTCTCTCACATTTTCTTCACATTGGT
TCGCATGCAGCCGGTTGTGGCCATTCTCTTAGCCACTATCGTTGGGTTTGGACTCACCATGAGCGGTACAACAGGTATAG
TCGAGTTTTCGAAATGGAGGAGAAGCAATAGGACAGCTGAACTTCCAAGCAGTAGTCAAGTGGATCAACCACTGGTTGAG
ACAACAGATCAGAACATTTCTGGATCAAGAAACTGA