Details for Arabidopsis Locus AT3G09735

Position : Chr3 ( 5`- 2986626 .. 2987969 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09735

Protein [Map View]
MAAEFDGKIESKGLNPGLIVLLVIGGLLLTFLVGNFILYTYAQKNLPPRKKKPVSKKKMKKEKMKQGVQVPGE*

DNA
ATGGCCGCAGAATTTGATGGAAAAATCGAAAGCAAAGGGCTAAACCCGGGACTGATCGTCCTTCTTGTAATAGGAGGGTT
GCTACTGACATTCCTTGTAGGAAACTTCATCCTTTACACATACGCACAGAAGAATTTACCTCCGAGGAAGAAGAAACCCG
TTTCTAAGAAGAAGATGAAGAAAGAGAAGATGAAGCAAGGCGTCCAAGTTCCTGGCGAGTAG