Details for Arabidopsis Locus AT3G09730

Position : Chr3 ( 5`- 2983934 .. 2986455 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09730

Protein [Map View]
MWQVILGAAIAGSTGFVAKRLFNPFSRDSPTPENYAEEQEPVTPPVSIGFLDSPCDKTNGVFRFSSSGSTVNSGSGSGSS
PGFRKSSGVKCRVRVRGLMKKKKKKNSGGCEIEKRSGNVGAFEMKSEVCSKKTKTLGAASASKHHSSFSSALGVCMMYMM
SAEKGEISKLHAATEETTKVIQELKDELSRIKSLQGFKFRGCAASSEKSGQIDLNRSEMVSRVSLDIKSGNDGEYASSVL
TEEPEQEAVEMEQLEMELESELQKLNLAETSDVMEECKDLVNGAESYQCGGISASELDKKLSHLLIEQQEGQINELEAEL
QTTQSKLQEKEAELQALKVCVRRLTEFPLLDRSDDEHEEDLNQDLSVSWSQHNKTDHEARKQIIGMKRPMEFVSSSHAKV
VVCAN*

DNA
ATGTGGCAAGTTATTCTAGGAGCAGCCATTGCTGGATCCACTGGTTTTGTAGCCAAACGCTTATTCAACCCTTTCTCTCG
AGATTCTCCTACTCCCGAGAATTACGCTGAAGAGCAGGAACCAGTCACTCCTCCTGTGAGCATTGGATTTCTCGATTCTC
CTTGCGACAAAACCAATGGCGTTTTCCGATTTTCTAGTTCCGGGTCTACCGTTAACTCAGGATCAGGATCCGGGTCTTCT
CCTGGGTTTAGGAAGAGTTCAGGGGTGAAATGTAGAGTTAGGGTTCGTGGATTGATGAAGAAGAAGAAGAAAAAGAATAG
TGGGGGATGTGAGATCGAGAAGCGATCTGGAAATGTTGGTGCTTTTGAAATGAAGAGTGAGGTTTGCTCGAAAAAGACGA
AAACTTTGGGTGCTGCTTCTGCTTCAAAACATCATTCCTCTTTCAGCTCAGCACTGGGTGTCTGCATGATGTATATGATG
TCAGCAGAGAAAGGTGAAATCAGTAAGCTGCATGCAGCAACAGAAGAAACTACCAAAGTCATCCAAGAGCTAAAAGATGA
ACTCTCTAGGATTAAATCTTTACAGGGTTTCAAGTTTCGTGGCTGTGCAGCAAGTTCTGAGAAATCTGGCCAGATAGATC
TCAATAGATCAGAGATGGTGAGTAGAGTATCTCTCGATATCAAGTCAGGCAATGATGGAGAATATGCTAGCAGCGTCCTA
ACTGAGGAGCCAGAACAAGAGGCAGTAGAAATGGAACAATTAGAGATGGAACTTGAATCTGAGCTGCAGAAATTGAACTT
GGCTGAGACAAGTGATGTTATGGAGGAATGTAAGGATTTGGTTAATGGAGCTGAGTCATACCAATGTGGTGGAATATCGG
CATCAGAGCTGGACAAGAAACTAAGCCACCTTCTCATCGAACAACAAGAAGGACAGATCAATGAGCTTGAAGCTGAACTA
CAAACTACTCAGTCCAAACTCCAAGAGAAGGAAGCTGAGCTTCAAGCACTTAAGGTCTGCGTTAGACGCCTAACAGAGTT
TCCTCTCTTGGACCGTTCAGATGATGAGCATGAAGAGGACCTGAATCAGGATCTCTCAGTCTCATGGAGCCAACATAACA
AAACTGATCACGAGGCAAGAAAGCAGATCATTGGGATGAAAAGGCCTATGGAGTTCGTATCATCAAGTCATGCCAAGGTG
GTGGTCTGTGCAAACTAG