Details for Arabidopsis Locus AT3G09690

Position : Chr3 ( 5`- 2971873 .. 2974843 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09690

Protein [Map View]
MEEMRRGVPTWQDELASLMDGGLQYDGSPIDLTADTESRSKSSGFESGSGSESVESLKDQVTGFMKSWGEMLMDLAIGCK
DVVQQMVVTDDSFVVRKLRKPAAKVSKKLSFLNEYLPEDRDPVHAWPVIFFVFLLALTALSFSSDHDRSVPLLKKIRLHP
TSASRVQLPDGRYLAYQELGVSADRARHSLIVPHSFLSSRLAGIPGVKESLLKDYGVRLVSYDLPGFGESDPHRARNLSS
SASDMIDLAAALGIVDKFWLLGYSSGSVHAWAAMRYFPDQIAGVAMVAPMINPYEPSMTKEEMAKTWEQWQRKRKFMYFL
ARRWPSLLPFSYRRSFLSGNLEPLDKWMSVSLGEKDKLVTADPVFEDLYQRNVEESVRQGTAKPFVEEAALQVSNWGFSL
PEFHMQKKCRTNGVLSWLMSMYSESECELIGFRKPIHIWQGMDDRVTPPSVTDYISRVIPEATVHRLPNEGHFSYFYLCD
ECHTQIFSAIFGEPKGPVELLEQRTETHRPDQPKTGLSDSSSLPKSK*

DNA
ATGGAGGAGATGCGAAGAGGAGTGCCTACGTGGCAAGACGAGTTAGCTAGTCTCATGGACGGAGGTTTACAATACGACGG
ATCTCCGATTGATTTGACGGCGGATACTGAATCGAGGTCAAAGAGTTCGGGTTTCGAGTCGGGTTCTGGATCCGAATCAG
TGGAGAGTTTGAAAGATCAAGTGACGGGGTTTATGAAGTCTTGGGGAGAAATGCTTATGGATCTCGCAATCGGATGCAAA
GACGTTGTGCAGCAGATGGTGGTGACCGACGACTCTTTCGTTGTAAGGAAGCTCCGGAAACCAGCTGCTAAGGTTTCGAA
GAAGCTTAGCTTCCTTAACGAGTACTTGCCTGAGGATCGTGATCCTGTTCATGCTTGGCCTGTGATTTTCTTCGTCTTCC
TCCTAGCTCTCACAGCATTGAGTTTTAGTTCAGACCATGATAGATCTGTCCCTTTGTTGAAGAAAATCCGTCTGCATCCT
ACTAGTGCAAGCCGTGTACAGCTTCCAGATGGTAGATATTTAGCTTACCAGGAGCTTGGTGTTTCAGCTGACAGAGCTAG
ACACTCTCTAATTGTTCCTCATTCTTTTCTTTCCTCTCGGCTTGCAGGTATACCTGGAGTAAAAGAATCATTGCTCAAGG
ACTATGGTGTTCGTCTAGTGTCATATGATCTTCCAGGGTTTGGAGAGAGTGATCCCCATCGTGCTCGGAACCTTAGCTCA
TCTGCCTCGGATATGATTGACCTAGCTGCTGCTCTAGGGATTGTTGACAAGTTCTGGTTACTCGGCTATTCCAGTGGTAG
TGTGCATGCCTGGGCTGCAATGAGATATTTTCCGGACCAAATAGCTGGAGTTGCCATGGTAGCGCCTATGATAAATCCAT
ATGAGCCAAGCATGACAAAGGAAGAGATGGCAAAAACGTGGGAGCAGTGGCAACGAAAGAGGAAATTCATGTACTTCTTA
GCACGTCGGTGGCCAAGTCTTCTTCCTTTCTCCTACCGTAGGTCCTTTCTCTCTGGTAATCTCGAGCCGCTGGATAAGTG
GATGTCAGTGTCATTAGGAGAAAAGGACAAACTTGTAACCGCAGATCCAGTTTTTGAAGATCTTTACCAAAGGAATGTGG
AGGAGTCTGTACGCCAAGGAACTGCAAAACCATTTGTGGAAGAAGCCGCATTACAGGTATCAAATTGGGGCTTTAGTCTT
CCCGAGTTCCACATGCAGAAGAAGTGTAGAACCAATGGCGTCCTCTCTTGGCTAATGTCAATGTACAGTGAATCCGAATG
TGAACTAATTGGTTTTCGGAAACCTATACACATATGGCAGGGTATGGACGACCGAGTCACTCCACCTTCAGTGACAGATT
ACATTAGTCGAGTCATACCAGAAGCAACGGTACATAGACTCCCAAACGAAGGCCACTTCTCTTACTTCTATCTCTGTGAT
GAGTGCCACACGCAGATCTTTTCGGCCATATTTGGAGAACCAAAGGGCCCGGTAGAGTTATTGGAACAAAGAACGGAAAC
CCATAGACCGGATCAACCAAAGACAGGTTTATCTGACAGTAGCTCACTACCAAAGAGTAAGTAA