Details for Arabidopsis Locus AT3G09670

Position : Chr3 ( 5`- 2966375 .. 2968972 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09670

Protein [Map View]
MSTESERIESVSEANASSLEVGNDQMSEALAGQAQELKTIGDDKEGCGNFASAGDNGMEKVNGFTNLVKETESVNGELDL
GTRTENVGGESNQSDKKVLVDSEEVMMVEKRGLLVEKEVEPDMVCSHGADLSDVKVSDGRLDSEDLVQDRKPDGLEKQGT
KVEDLDVVCFMGLEPHESKDESILDDEIAHVAAKVKISDSDLVWAKVRSHPWWPGQVFDASAATDKAKKHFKKGSFLVTY
FGDCTFAWNEASRIKPFRQHFSQMAKQSSLPDFIDAIDFALEEVSRRIEFGLACSCISEEVYQKIKTQNVINPGIREDSS
SIHGGDKVSSAVFFEPANLVGYVKRLACSPSYDATDALQLVSQRAQLLAFNRWKGYTDLPEFMTLQGSVESAPKISPAEE
QSSLVEVSDPEPTKSKQVYTKRRKTNLQTEQSSLVEVSDPDKGDCKHDGVFEYEETIVPKKKEKTLAEFIAEKRVSRHNG
NTSHEKSGNVPHCEKKRKVVQSKVPKSTKKIKANLQTEDPGSPVSPKNDRKNNLSAGDKITPQKARKSFGIGASILKVAN
QMHCSTPTRLLPCSDSTSKKAAKSNGSGKSLQEKPKAEALSAREISPSTTLSSPHAASVTKTTSGKSNSVSLDHNLSGEL
DQVRKEAPSTNLVEDPMLESRDLKDSSKEQVVHEDKKEAANVADEKSIMDSNLTGEKISGLDLREQPSNKNCSGGSDSCK
EDVSAE*

DNA
ATGTCGACGGAATCAGAACGTATTGAATCAGTCTCAGAGGCTAATGCGTCGAGTTTAGAGGTCGGAAATGATCAAATGTC
TGAAGCCCTAGCTGGTCAAGCTCAGGAGCTGAAAACAATTGGAGATGATAAAGAAGGATGCGGCAACTTTGCTTCAGCTG
GTGATAATGGGATGGAGAAAGTAAATGGATTTACTAATCTTGTTAAGGAAACGGAATCTGTAAATGGAGAGTTAGATCTA
GGCACTAGAACCGAAAATGTAGGTGGAGAGAGTAACCAAAGTGACAAGAAGGTTCTAGTAGATAGCGAAGAGGTCATGAT
GGTAGAGAAAAGGGGGCTTCTTGTTGAGAAGGAAGTGGAACCTGACATGGTCTGTTCTCATGGCGCTGATCTCAGTGATG
TGAAGGTTTCTGATGGCAGACTGGATAGTGAAGACCTTGTTCAGGATAGAAAACCCGATGGCTTAGAAAAGCAAGGAACA
AAAGTTGAGGACTTGGATGTTGTATGTTTTATGGGTTTAGAACCGCATGAGAGCAAGGATGAGAGTATTTTGGATGATGA
AATTGCCCATGTAGCTGCGAAGGTGAAGATCTCTGACTCAGATTTGGTTTGGGCTAAAGTAAGGAGCCATCCGTGGTGGC
CTGGACAGGTGTTTGATGCCTCGGCTGCAACAGACAAGGCGAAGAAGCATTTCAAGAAAGGAAGTTTCTTAGTAACTTAT
TTTGGAGATTGCACCTTTGCTTGGAATGAGGCGTCACGGATTAAGCCTTTTCGACAGCATTTCTCCCAAATGGCAAAGCA
GAGTAGTCTACCTGATTTTATTGATGCTATTGATTTTGCGTTAGAAGAGGTATCAAGAAGGATAGAGTTTGGTTTAGCTT
GTTCTTGTATCTCAGAGGAAGTCTATCAGAAGATCAAGACTCAGAATGTAATCAATCCTGGAATCCGAGAAGATTCAAGC
TCAATACACGGTGGAGACAAGGTCTCAAGTGCAGTCTTCTTTGAACCTGCAAACCTTGTGGGATATGTGAAGCGTTTAGC
ATGCTCTCCTAGCTATGATGCTACTGATGCGCTGCAGCTTGTAAGTCAGAGAGCACAGTTATTAGCTTTTAATCGCTGGA
AAGGCTATACTGACCTCCCCGAGTTTATGACACTCCAGGGGTCAGTAGAGTCTGCACCCAAGATTTCTCCTGCAGAAGAG
CAAAGTAGCTTAGTGGAAGTTTCTGATCCTGAACCAACAAAGAGTAAACAAGTTTATACTAAAAGAAGAAAGACAAACCT
GCAAACAGAGCAAAGTAGCTTAGTTGAAGTTTCTGATCCTGATAAAGGTGACTGTAAACACGATGGAGTGTTTGAATATG
AAGAAACTATTGTTCCAAAGAAAAAGGAGAAAACTTTGGCAGAGTTCATTGCTGAGAAACGCGTAAGCAGACATAATGGG
AACACATCACATGAAAAGTCTGGTAATGTTCCGCATTGCGAAAAGAAACGCAAGGTTGTGCAGTCAAAAGTTCCCAAGTC
CACGAAAAAGATTAAGGCAAACCTGCAAACAGAGGATCCAGGATCTCCAGTTTCTCCCAAAAATGATCGAAAAAATAATT
TGTCTGCTGGTGATAAGATTACACCACAGAAAGCTAGAAAAAGTTTCGGAATTGGGGCAAGCATATTGAAAGTGGCAAAC
CAGATGCATTGTTCAACACCAACCAGACTCTTACCTTGCAGTGATTCGACCTCCAAAAAGGCAGCCAAGAGCAATGGCAG
TGGAAAGAGTCTTCAGGAGAAACCTAAAGCCGAAGCATTATCAGCAAGAGAAATTTCTCCTTCAACTACACTTTCAAGCC
CTCACGCTGCTTCTGTTACCAAAACCACAAGTGGGAAATCCAATTCTGTCAGCCTAGACCACAACCTATCCGGAGAACTT
GATCAGGTCAGAAAGGAAGCTCCTAGTACTAACCTTGTGGAGGACCCGATGTTGGAGTCTAGAGACTTGAAAGACTCTTC
TAAGGAGCAGGTCGTACATGAGGATAAGAAAGAAGCTGCAAATGTAGCGGATGAGAAATCTATTATGGACAGCAATCTAA
CCGGGGAGAAAATCAGTGGCTTGGACTTGAGAGAGCAGCCGAGTAACAAGAACTGCTCTGGTGGATCTGATAGTTGCAAG
GAAGATGTTTCTGCAGAGTAG