Details for Arabidopsis Locus AT3G09640

Position : Chr3 ( 5`- 2956156 .. 2958327 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09640

Protein [Map View]
MVKKSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTKTGGPFGTIRHPQELAHDANNGLDIAVR
LLDPIKELFPILSYADFYQLAGVVAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVDHLRDVFGRMGLNDKDIVALS
GGHTLGRCHKERSGFEGAWTPNPLIFDNSYFKEILSGEKEGLLQLPTDKALLDDPLFLPFVEKYAADEDAFFEDYTEAHL
KLSELGFADKE*

DNA
ATGGTGAAGAAGAGTTACCCGGAAGTGAAAGAAGAGTACAAGAAAGCTGTTCAGAGATGCAAGAGGAAGCTCCGTGGTCT
TATTGCCGAGAAGCACTGTGCTCCCATCGTCCTCCGTCTTGCATGGCACTCGGCTGGGACATTTGATGTGAAGACGAAGA
CAGGAGGACCGTTTGGGACGATAAGGCATCCCCAAGAGCTAGCCCATGATGCCAACAATGGTCTTGATATTGCCGTTAGG
CTTCTTGACCCTATCAAGGAGCTGTTCCCTATTCTGTCATATGCTGACTTCTACCAGCTAGCTGGAGTAGTTGCTGTTGA
GATCACTGGAGGACCAGAGATTCCATTTCATCCTGGTAGACTGGACAAAGTTGAGCCACCTCCTGAAGGTCGTCTGCCTC
AGGCCACCAAAGGTGTGGATCATCTAAGAGATGTGTTTGGTCGGATGGGACTCAATGACAAAGATATCGTTGCATTGTCT
GGTGGACACACCTTGGGTCGGTGCCACAAGGAGCGTTCAGGATTCGAGGGTGCATGGACACCAAACCCGCTCATTTTTGA
CAACTCCTATTTCAAAGAGATACTAAGCGGAGAGAAAGAAGGACTTCTTCAACTACCAACCGACAAGGCTCTTCTTGATG
ATCCTCTCTTTCTCCCATTTGTTGAAAAATATGCTGCAGATGAGGATGCCTTCTTCGAAGACTATACGGAAGCTCATCTA
AAGTTGTCAGAACTCGGGTTTGCTGACAAGGAGTAA