Details for Arabidopsis Locus AT3G09620

Position : Chr3 ( 5`- 2949152 .. 2952205 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09620

Protein [Map View]
MLEKSKSRKENDRKDRDRSKKENGRRDTTEMRSRVKRCDSEEEERIRIRRDRKSSDFEEEEYERDSKRRGEDKGRGRRER
DRDRGKYLKRDRERREREKEKGRKKQKKERSREDCNEESDDVKCGLKRKRTERSRHGDDDVEKKTRDEQVEDEQKQLAEE
VEKRRRRVQEWQELKRQNEEAQIESKGPETGKAWTLDGESDDEVKSDSEMDVDRDTKLENGGDAKMVASENETAVTVSEN
GGDRAADEDEIDPLDAFMNTMVLPEVEKLSNIVIDGILDFKMNGKETGDQAKKGFNKAALGRIIQGEDSDSDYSEPKSDD
DPSLDEDDEEFMKRVKKTKAEKLSLVDHSKIEYEPFRKNFYIEVKDISRMTQDAVNAYRKELELKVHGKDVPRPIQFWHQ
TGLTSKILDTLKKLNYEKPMPIQAQALPIIMSGRDCIGVAKTGSGKTLGFVLPMLRHIKDQPPVEAGDGPIGLVMAPTRE
LVQQIYSDIRKFSKALGIICVPVYGGSGVAQQISELKRGTEIVVCTPGRMIDILCTSSGKITNLRRVTYLVMDEADRMFD
MGFEPQITRIVQNIRPDRQTVLFSATFPRQVETLARKVLNKPVEIQVGGRSVVNKDITQLVEIRPESERFSRLLELLGEW
YEKGKVLVFVRSQEKSISDFKSDVCNLLIATSVAARGLDVKELELVVNFDAPNHYEDYVHRVGRTGRAGRKGCAVTFISE
DDAKYAPDLVKALELSEQPVPDDVKAVAEGFMAKVKQGIEQAHGTGYGGSGFKFNEEEDEVRKAAKKAQAKEYGFEEEKS
DSEDENDVVRKAGGDISQQQITLAQIAAIASAASKAPVTANQLLPNGGGLATEPGIPPTDGAGRVAAMIAAANVQQYLAK
IQADAIPEHYEAELEINDFPQNARWKVTHKETLGPISEWSGASITTRGKFYEAGRIPGPEERKLYLFVEGPTEISVKTAK
AELKRVLEDITNQTFSLPGGAQSGRYSVL*

DNA
ATGTTAGAGAAATCTAAGTCCAGGAAGGAAAATGATCGCAAAGATCGTGATCGCAGTAAGAAAGAGAATGGTCGGCGAGA
TACGACGGAGATGCGCTCGAGAGTTAAGAGATGCGATTCTGAGGAAGAGGAGAGGATACGGATACGGAGGGATAGAAAAA
GTAGCGATTTTGAAGAAGAAGAATACGAGAGGGATAGTAAACGCAGAGGGGAGGACAAGGGAAGAGGACGCCGAGAACGT
GACAGAGATAGAGGAAAATATCTGAAAAGGGACAGAGAGAGGAGAGAACGTGAGAAAGAAAAGGGTAGGAAGAAACAGAA
AAAGGAGAGGTCACGTGAGGATTGTAATGAAGAGAGTGATGATGTCAAGTGTGGCTTGAAACGCAAAAGAACGGAGCGTA
GCAGGCATGGAGATGACGATGTTGAGAAGAAAACTCGGGATGAACAAGTAGAGGATGAGCAGAAGCAGTTGGCTGAGGAA
GTAGAAAAACGGAGGAGAAGAGTCCAGGAGTGGCAAGAGTTGAAGAGGCAAAACGAGGAAGCTCAAATTGAAAGTAAGGG
TCCTGAGACCGGTAAGGCTTGGACTCTTGATGGTGAATCTGATGATGAAGTTAAATCAGACTCAGAGATGGATGTTGATC
GTGATACTAAACTCGAAAATGGTGGAGATGCCAAGATGGTCGCCTCGGAGAATGAGACAGCTGTTACTGTCTCTGAGAAT
GGAGGTGACAGAGCTGCAGATGAAGACGAAATTGATCCCTTAGATGCTTTTATGAATACTATGGTATTACCTGAGGTTGA
AAAGCTTAGCAATATTGTGATCGATGGTATTTTGGATTTTAAAATGAATGGGAAGGAAACTGGTGACCAAGCCAAAAAAG
GTTTTAATAAGGCCGCCCTTGGTAGGATAATTCAAGGTGAAGATTCTGATTCAGATTACTCAGAACCAAAGAGTGATGAT
GATCCAAGTTTAGACGAAGACGACGAGGAGTTTATGAAGAGAGTTAAGAAGACAAAAGCAGAGAAATTGTCTCTTGTTGA
CCACTCCAAAATAGAGTATGAACCTTTCCGGAAGAATTTTTATATCGAAGTCAAGGATATCTCAAGGATGACACAGGATG
CAGTGAACGCTTATAGAAAGGAATTGGAGCTGAAAGTTCATGGGAAAGATGTTCCAAGACCCATTCAATTTTGGCACCAG
ACTGGATTAACTAGCAAAATTTTGGATACTCTGAAGAAGCTTAACTATGAAAAGCCAATGCCTATCCAAGCACAAGCACT
TCCAATCATCATGAGCGGTAGAGACTGCATTGGGGTTGCCAAAACCGGGTCAGGTAAAACCCTTGGCTTTGTTTTGCCTA
TGTTGAGGCATATCAAAGATCAGCCTCCCGTTGAAGCTGGTGATGGGCCGATTGGGCTTGTAATGGCACCTACTAGAGAA
CTTGTTCAGCAGATTTACAGCGATATCAGAAAGTTTTCTAAGGCATTGGGTATAATATGTGTGCCTGTGTATGGAGGATC
TGGAGTTGCCCAGCAAATCAGTGAGCTTAAGCGAGGTACCGAGATTGTTGTTTGTACTCCTGGAAGAATGATCGATATTC
TTTGCACAAGCAGTGGAAAAATTACCAATCTACGAAGGGTCACATATTTGGTAATGGATGAAGCTGATCGTATGTTTGAT
ATGGGTTTTGAGCCTCAAATAACTCGCATTGTTCAAAATATTCGACCTGATCGTCAAACTGTGCTCTTTTCTGCCACTTT
TCCACGCCAAGTTGAAACTTTGGCACGTAAAGTCTTGAACAAGCCTGTGGAGATACAGGTCGGTGGGAGGAGTGTTGTGA
ATAAAGATATAACTCAGTTAGTTGAAATCAGACCCGAGAGTGAGAGGTTCTCAAGACTTCTGGAACTTCTTGGGGAATGG
TATGAGAAAGGAAAAGTTTTGGTCTTTGTTCGTTCGCAGGAAAAATCTATATCTGATTTTAAGAGCGATGTCTGCAATTT
GTTGATCGCCACAAGTGTTGCAGCCAGGGGTCTAGATGTGAAAGAGCTCGAGTTGGTTGTAAACTTCGATGCACCAAACC
ACTATGAAGACTATGTGCATCGTGTTGGTAGGACAGGTAGGGCAGGGCGGAAAGGCTGTGCTGTAACATTTATCTCTGAG
GATGATGCAAAATATGCACCAGATTTAGTCAAGGCCCTGGAACTATCTGAGCAGCCAGTTCCTGATGATGTTAAAGCAGT
AGCCGAAGGGTTCATGGCGAAAGTAAAACAGGGTATTGAGCAAGCTCATGGAACTGGCTATGGTGGAAGTGGCTTTAAAT
TCAACGAAGAGGAGGATGAAGTTAGGAAAGCAGCAAAGAAAGCACAAGCGAAGGAGTATGGCTTTGAAGAAGAGAAGTCT
GACTCAGAAGATGAGAATGATGTAGTAAGAAAGGCTGGTGGTGATATCTCACAGCAGCAGATTACTCTTGCTCAGATAGC
CGCCATTGCTTCTGCTGCTTCTAAGGCTCCTGTGACTGCTAACCAATTGCTTCCAAATGGTGGTGGGCTAGCCACTGAGC
CAGGTATCCCTCCTACTGATGGAGCAGGCCGCGTTGCAGCCATGATTGCTGCTGCTAACGTGCAACAGTACCTTGCAAAG
ATTCAAGCTGATGCGATACCTGAACACTATGAAGCAGAATTGGAAATCAATGATTTCCCACAGAATGCTCGGTGGAAAGT
TACCCACAAAGAAACGCTGGGACCAATATCAGAGTGGAGTGGAGCTTCCATTACCACTAGAGGTAAGTTTTATGAGGCAG
GACGTATCCCGGGACCTGAGGAACGCAAGCTCTATTTGTTCGTCGAAGGGCCTACCGAAATATCTGTTAAGACAGCGAAA
GCTGAACTCAAGCGTGTTCTTGAAGACATAACTAACCAAACCTTCTCCCTTCCTGGAGGAGCACAATCAGGCAGATACTC
TGTTTTATAA