Details for Arabidopsis Locus AT3G09560

Position : Chr3 ( 5`- 2934617 .. 2939456 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09560

Protein [Map View]
MSLVGRVGSLISQGVYSVATPFHPFGGAIDVIVVQQQDGSFRSTPWYVRFGKFQGVLKGAEKFVRISVNGTEADFHMYLD
NSGEAYFIREVDPAANDTNNLISGSENNNGNQNNGVTYRLEHSLSDSGTGELREGFDPLSRLERTESDCNRRFYDFQDDP
PSPTSEYGSARFDNLNVESYGDSQGSDSEVVLVSIDGHILTAPVSVAEQEAENLRLNTPQFHLAPGDGTEFCEGNTEFAS
SETPWDTEYIDKVEESSDTANIASDKVDAINDERNDLDSHSRDNAEKDSHDAERDLLGSCLEQSELTKTSENVKSEEPGP
TFEDRNLKEGEFPLRTIMENDRSEDEVTIESIDTLVDSFESSTTQITIEEVKTTEGSRISVDSNADSECKDEQTSAETAI
LFNNQESSISVDSNADSECKDEQPRISAETAILINNQEGGIIESEDQDSERVSIDSTREEVDKDNEDRKTVVSVGVTSSV
DEGEPDTDQRYELSLCKDELRQGMGLSAAAEVFDAHMISKEEYINSATSILESENLVVRIRETYMPWTKAARIVLGKAVF
DLDLDIQPDDVISVEENESPKPKDDETTITPSSSGTRWRLWPIPFRRVKTVEHTGSNSSSEEDLFVDSEPGLQNSPETQS
TTESRHESPRRQLVRTNVPTNEQIASLNLKDGQNMITFSFSTRVLGTQQVDAHIYRWRWDTKIVISDVDGTITKSDVLGQ
FMPFIGKDWTQSGVAKLFSAIKENGYQLLFLSARAIVQAYLTRNFLNNLKQDGKALPTGPVVISPDGLFPALYREVIRRA
PHEFKIACLEDIRKLFPTDYNPFYAGFGNRDTDELSYRKLGIPKGKIFIINPKGEVATGHRIDVKKSYTSLHTLVNDMFP
PTSLVEQEDYNPWNFWKLPIEEVE*

DNA
ATGAGTTTGGTTGGAAGAGTTGGGAGTTTGATTTCTCAAGGGGTTTACTCTGTAGCGACACCATTTCATCCCTTTGGTGG
TGCTATTGATGTCATCGTTGTTCAACAACAAGATGGTTCTTTCCGTAGCACGCCTTGGTATGTTAGGTTTGGTAAGTTCC
AAGGTGTTCTCAAAGGCGCTGAGAAGTTTGTCAGGATTTCTGTTAATGGAACCGAAGCTGATTTTCACATGTATCTTGAT
AATTCTGGTGAAGCATATTTCATCAGGGAAGTTGATCCTGCAGCTAATGACACCAACAATTTGATTTCCGGGTCTGAGAA
TAACAATGGTAATCAGAATAACGGTGTTACTTATCGACTTGAGCACAGTTTATCGGACTCTGGTACTGGAGAATTACGAG
AGGGTTTCGACCCTTTGAGTCGGCTTGAGAGGACAGAGTCTGATTGTAATAGGAGGTTTTATGATTTTCAGGATGATCCT
CCTTCGCCAACCTCAGAATATGGAAGTGCTCGATTTGACAATCTAAATGTGGAAAGTTATGGGGATTCTCAAGGCTCAGA
TTCTGAAGTGGTTTTGGTCAGTATTGATGGACATATACTAACAGCCCCTGTGTCAGTTGCTGAGCAGGAGGCTGAGAATT
TACGGTTAAATACTCCTCAGTTTCATTTGGCCCCTGGTGATGGGACTGAGTTTTGTGAAGGTAATACTGAGTTTGCTTCA
TCAGAGACTCCGTGGGATACTGAATATATCGACAAAGTGGAGGAGTCATCTGATACTGCTAATATTGCATCTGATAAAGT
AGATGCCATTAATGATGAGCGTAATGATTTGGATTCCCATTCTCGTGATAATGCCGAAAAAGATTCTCATGATGCTGAAA
GAGATCTTCTTGGGAGCTGTCTGGAGCAGTCAGAGCTGACCAAAACTAGTGAGAATGTGAAGTCTGAGGAACCAGGTCCT
ACTTTTGAGGATCGGAATCTAAAAGAAGGTGAGTTTCCACTTCGCACCATTATGGAAAATGATAGAAGTGAAGATGAAGT
TACTATTGAATCAATAGATACTCTTGTTGATAGTTTTGAATCTTCTACAACCCAAATAACAATAGAAGAAGTGAAAACAA
CCGAAGGATCCAGAATATCCGTTGATTCTAATGCTGATTCAGAATGTAAGGATGAACAAACATCTGCAGAAACTGCCATC
TTGTTTAACAACCAGGAATCCAGTATATCCGTTGATTCTAATGCTGATTCAGAATGTAAGGATGAACAGCCACGAATATC
TGCAGAAACTGCCATCTTGATTAACAACCAGGAAGGTGGGATTATAGAATCGGAAGACCAGGATTCTGAGAGAGTCTCTA
TAGATTCAACGAGGGAGGAAGTTGATAAGGATAACGAGGACAGGAAGACTGTAGTTTCAGTGGGTGTGACTTCTAGTGTC
GACGAAGGAGAACCCGATACAGATCAGAGATATGAGTTATCACTTTGCAAGGATGAGCTTCGTCAGGGTATGGGACTTAG
CGCAGCTGCTGAAGTCTTTGATGCACATATGATCTCCAAGGAAGAATATATAAATTCGGCCACATCAATTCTTGAAAGTG
AAAATCTGGTTGTTAGGATTAGAGAAACGTATATGCCATGGACGAAAGCTGCTCGAATTGTGCTTGGGAAAGCTGTGTTT
GATCTAGACTTAGATATCCAGCCAGATGATGTGATTTCTGTGGAGGAAAATGAATCGCCTAAGCCCAAGGATGATGAAAC
TACAATAACTCCTTCTTCATCTGGAACAAGATGGAGACTCTGGCCGATTCCTTTTAGAAGGGTTAAAACTGTTGAGCATA
CGGGAAGTAACTCCTCAAGCGAAGAAGATCTGTTTGTTGATTCCGAACCTGGCTTACAGAACTCACCGGAAACACAATCA
ACCACAGAGAGTCGCCATGAGTCTCCGCGTAGACAACTTGTGAGAACTAATGTCCCTACCAATGAACAGATCGCATCTCT
GAATCTGAAAGATGGTCAGAATATGATAACATTTAGTTTCTCAACAAGAGTTCTTGGAACACAACAGGTCGATGCTCACA
TTTACCGGTGGAGATGGGACACCAAGATAGTGATTTCAGATGTTGATGGAACTATAACTAAATCTGATGTGTTAGGTCAG
TTCATGCCCTTCATTGGAAAGGACTGGACCCAATCCGGTGTAGCCAAGCTTTTTTCTGCCATAAAGGAGAATGGATATCA
GTTACTGTTTTTGAGCGCTCGTGCCATCGTTCAGGCATATCTAACAAGAAATTTCTTAAATAATCTGAAGCAGGACGGAA
AAGCTCTGCCAACCGGTCCTGTGGTCATTTCACCAGATGGCCTATTTCCAGCATTGTACCGTGAAGTGATAAGAAGAGCA
CCTCATGAGTTCAAGATCGCATGTTTGGAGGATATCAGGAAACTCTTCCCAACGGATTACAACCCGTTCTATGCCGGATT
TGGAAATAGAGACACAGATGAGCTGAGTTACAGAAAACTCGGAATCCCAAAGGGAAAGATATTCATAATCAACCCAAAGG
GAGAAGTGGCAACAGGACATCGCATAGATGTCAAGAAATCTTACACTTCACTTCATACTCTTGTCAACGACATGTTTCCT
CCAACTTCACTTGTTGAGCAGGAAGATTATAACCCATGGAATTTCTGGAAACTGCCAATAGAAGAGGTTGAATGA