Details for Arabidopsis Locus AT3G09540

Position : Chr3 ( 5`- 2928811 .. 2931228 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09540

Protein [Map View]
MGNLHGIHRSHHGGSNFPGEAPNSPFPPPYTAAPAPAPAPSSPSDHHMTVGPYCHVDSSLRSLAGKAEGFGRAAVGGLNG
PICHVTSLADEGPGSLREACKRPEPLWIVFDVSGTINLSSFVNVSSHTTVDGRGQKVKITGKGLRLKECENVIICNLEFE
GGVGPDADAIQIKPKSHNIWIDRCSLKNYYDGLIDITRESTDITVSRCHFMNHNKTMLIGADTSHVTDRCIRVTIHHCFF
DGTRQRHPRVRFAKVHLFNNYTRHWAIYAVGAGVESQIHSQCNIYEAGEKKTVFKYITEKAADKEKPGAGFVRSEGDLLL
NGAKSCLSQGGERYVFSPIQHYSEWTVESPTDILKNYLKHSTGWQNLPLPLDRPPTTA*

DNA
ATGGGAAACTTACATGGCATTCACAGATCCCATCACGGCGGTTCTAATTTTCCCGGCGAAGCTCCCAATTCACCTTTCCC
ACCACCATATACAGCCGCTCCAGCTCCAGCTCCAGCTCCGTCATCGCCATCCGATCACCACATGACAGTGGGACCTTATT
GCCACGTAGACTCCAGCCTCCGCTCTCTCGCCGGAAAGGCCGAAGGTTTCGGCCGCGCCGCCGTTGGTGGTCTAAATGGT
CCGATTTGCCACGTCACTTCTTTAGCTGACGAGGGTCCAGGATCGTTGCGAGAGGCTTGCAAGAGGCCAGAACCTTTATG
GATCGTGTTCGATGTATCGGGAACGATCAATCTGTCTTCGTTTGTCAACGTATCATCGCACACAACGGTGGACGGGAGAG
GACAAAAAGTGAAGATAACGGGAAAAGGGTTAAGGCTAAAAGAGTGTGAAAACGTTATAATCTGCAATCTTGAATTTGAA
GGCGGTGTGGGACCAGACGCAGACGCTATTCAGATCAAACCAAAATCGCACAATATTTGGATTGATCGGTGTAGTCTCAA
GAATTACTATGATGGTTTGATTGATATCACACGAGAAAGCACTGACATCACTGTCTCAAGATGCCATTTCATGAACCACA
ACAAAACTATGTTAATAGGAGCGGACACAAGTCACGTTACGGACCGATGCATAAGAGTTACGATACATCACTGCTTCTTC
GACGGTACACGTCAGCGACACCCTCGCGTTCGCTTCGCAAAAGTCCATCTCTTCAACAACTACACTCGTCATTGGGCCAT
TTACGCTGTTGGTGCTGGTGTCGAATCTCAGATACATTCTCAGTGCAACATATATGAAGCTGGTGAAAAGAAAACTGTCT
TTAAGTACATCACTGAGAAGGCCGCTGATAAAGAGAAACCCGGAGCTGGATTCGTAAGATCAGAAGGGGATTTGTTGTTG
AACGGAGCCAAATCGTGTCTTAGTCAGGGCGGAGAGCGCTATGTGTTCTCTCCAATCCAACACTATTCTGAATGGACCGT
CGAATCTCCAACCGATATACTCAAGAACTATCTGAAACACTCGACCGGCTGGCAGAACCTTCCCCTCCCACTAGACCGGC
CTCCGACCACCGCATAA