Details for Arabidopsis Locus AT3G09500

Position : Chr3 ( 5`- 2916952 .. 2918108 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09500

Protein [Map View]
MARIKVHELREKSKSDLQNQLKELKAELALLRVAKVTGGAPNKLSKIKVVRKSIAQVLTVSSQKQKSALREAYKNKKLLP
LDLRPKKTRAIRRRLTKHQASLKTEREKKKEMYFPIRKYAIKV*

DNA
ATGGCGAGGATTAAGGTTCACGAATTGAGGGAGAAGTCGAAGAGCGATCTTCAAAACCAGCTGAAGGAACTCAAAGCTGA
GCTCGCTCTCCTCCGTGTCGCTAAAGTCACCGGAGGTGCTCCAAACAAGCTCTCTAAAATCAAGGTCGTGCGTAAATCCA
TAGCTCAGGTTTTGACAGTGTCTTCTCAGAAGCAGAAGTCTGCTCTAAGAGAAGCATACAAGAACAAGAAGTTGCTTCCT
CTTGATCTCCGTCCCAAGAAGACCCGTGCTATTCGTAGACGCCTCACCAAACACCAGGCCTCGTTGAAGACAGAGCGTGA
GAAGAAGAAGGAGATGTATTTCCCAATAAGGAAGTACGCTATCAAAGTTTAA