Details for Arabidopsis Locus AT3G09490

Position : Chr3 ( 5`- 2915559 .. 2916673 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09490

Protein [Map View]
MASPATFQFSRTKLNLQINLVERKSPSKLSFPLLFRDQAKSTPIRFPVIRASSSSSASNHKPSLLKTTFISLTAAAALFS
ASFYFVNKRAAMTPVAVVETTLEKHLETQSNDVNALSLLTEIKFKSDKHEQAIVFLDRLIEIEPYERKWPAMKARILSYH
GKSESAIEAFEEILEKDPIRVDAYHYLVMEYYNSKPKLTEIEKRINKVIRRCKKEKKTKEILGFRMLIAQIRFIEGKSVE
AIRICEELVKEDPNDFTIYLFQGVVYTLMNKGEEAAKQFEHVARVIPRNHPSRETAARTTNSNEWRVIVAYDNVYCYLST
FARLSMASLFNKFG*

DNA
ATGGCGTCTCCGGCGACGTTTCAATTCTCTAGAACAAAACTTAACCTTCAGATCAACCTCGTCGAGCGAAAATCTCCTTC
AAAACTCTCGTTTCCTCTTTTATTCAGAGACCAAGCAAAGTCAACACCAATCAGATTTCCCGTCATAAGAGCTTCATCAT
CTTCGTCGGCGTCAAATCATAAACCTTCACTGCTTAAAACCACCTTCATCAGCCTCACCGCAGCCGCAGCTCTGTTCTCA
GCATCGTTTTACTTCGTCAACAAACGCGCCGCGATGACTCCAGTTGCTGTGGTAGAGACGACACTCGAGAAGCACCTCGA
GACACAATCAAACGATGTGAATGCTTTATCATTGCTGACGGAAATCAAATTTAAGTCCGATAAACATGAGCAGGCGATTG
TATTTCTGGACCGTCTGATCGAGATCGAGCCATATGAACGAAAATGGCCGGCTATGAAGGCTCGGATTCTCTCATACCAC
GGGAAAAGTGAATCAGCAATCGAAGCTTTCGAGGAGATTCTCGAAAAGGATCCGATACGCGTCGATGCTTATCATTACTT
GGTGATGGAGTATTACAACTCTAAACCTAAATTAACAGAGATAGAGAAGAGGATCAACAAAGTGATTCGAAGATGCAAGA
AGGAGAAGAAGACGAAAGAGATTCTCGGTTTCAGAATGTTGATCGCACAGATTAGGTTTATTGAAGGAAAATCAGTTGAA
GCAATTCGGATTTGTGAAGAGCTAGTGAAGGAAGATCCAAATGATTTCACTATATATTTGTTTCAAGGAGTCGTGTATAC
ATTGATGAATAAGGGAGAGGAAGCTGCGAAGCAATTTGAGCATGTTGCTAGGGTTATACCAAGGAATCACCCGTCTAGAG
AGACTGCCGCGAGGACCACGAACTCAAATGAATGGAGAGTCATCGTAGCTTACGATAATGTCTACTGCTATTTATCTACA
TTTGCTAGGCTTTCCATGGCTTCTTTGTTTAATAAGTTTGGCTAA