Details for Arabidopsis Locus AT3G09450

Position : Chr3 ( 5`- 2907548 .. 2910091 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09450

Protein [Map View]
MRDTTWLERLGLALRTAMACLIVSLTTLYGPKPLRHFTTFPAFSYLTTILIWLSDAEPTYGEVLKCCLDVSYATFQTIAI
ALVSVLVVGPASLGNGLVAPVAVALASFIVAFPVSTSLLTKRIAFGQIVVVYVTFVVFNGEVAHVFMLPVHVAGSTALGA
IASLIAVLLPFPRLAHSQMSKGCKLYAENALERLNMFVEIMMARDNTTAQVLIARAASLSAAAKNTLKNIKIHHERISWE
RPDTRFLSRKQKLDPAEKLHATDFLLRGLELALGSCSSFPQGMSRDELTRLLEGPRTHIAPRSESTLKSQDSLGWHHEAE
SLSTAALPVCFFRYCVELFRGDFLSLRQDSKSVNGRTTEEEIHPANEGLSMARKFWDILCVWMARERFVFAFKCSISLGL
AVLFGILYNKNNGYWSGLTVAISLVSGRQATLTVANSRLQGTAMGSVYGLICCSVFQRLEEFRFLPLLPWIILAVFMRHS
KVYGQPGGVTAAIAALLILGRRNYGAPTEFAIARIVEASIGLLCFVFGEILVTPARAATLARTEISHCLDALLDCIQSLV
LCSEQKNQKVVADLRKSQVKLKSHVEALERFAAEALTEPKIPFLRRLNTDSYNRLLGSFSKISDLCLYVCDGLKNLSGVQ
PTLAFPWDNITHELRAFQEKLHPSVKCLKEISQTKSQARLQKELQKRKICHDVEAGTTSNDNYSYMELGPSQADVERFSV
SFVMLLKEATDKISCNTADDAFKSETALCLSSLGFCISRLMQETICIMTEITHTT*

DNA
ATGCGCGACACAACATGGCTCGAGCGACTTGGCCTGGCTCTGCGAACCGCCATGGCTTGTCTCATCGTGAGCTTAACCAC
TTTGTACGGTCCCAAACCACTAAGACACTTCACAACGTTTCCAGCCTTTTCTTACCTGACCACAATCTTGATCTGGCTCT
CCGATGCTGAACCAACATACGGCGAAGTTCTCAAGTGCTGTCTTGATGTCTCTTACGCCACTTTTCAGACAATAGCCATT
GCGCTAGTGAGTGTCTTGGTGGTTGGACCAGCTTCACTAGGGAATGGCTTGGTGGCTCCAGTTGCTGTGGCTCTAGCTTC
ATTCATAGTGGCTTTCCCCGTGTCCACGAGTCTGCTGACTAAACGGATTGCCTTTGGGCAGATTGTTGTAGTCTACGTGA
CTTTTGTGGTGTTCAATGGAGAGGTGGCTCATGTATTCATGCTCCCGGTTCATGTGGCAGGCAGTACAGCACTTGGAGCC
ATTGCTTCACTCATCGCAGTGCTTCTCCCGTTTCCAAGGCTGGCTCATAGTCAGATGAGTAAGGGTTGCAAATTATATGC
TGAAAATGCTCTTGAGAGGTTGAATATGTTTGTGGAGATCATGATGGCACGAGACAACACCACAGCTCAGGTTTTGATCG
CACGGGCTGCTTCATTGTCTGCAGCAGCTAAAAACACACTCAAGAACATCAAAATCCACCATGAGCGTATATCATGGGAG
AGACCAGATACAAGATTCTTGAGCAGGAAGCAGAAGTTGGATCCTGCAGAGAAACTGCATGCAACAGATTTTCTGTTGAG
GGGATTGGAGCTGGCTTTGGGCTCTTGCAGTTCCTTTCCTCAAGGCATGAGCCGCGACGAACTGACTCGTCTTTTAGAAG
GTCCCAGGACACATATTGCTCCACGGTCAGAATCTACTCTCAAGTCCCAAGATAGTCTAGGGTGGCATCATGAGGCTGAG
TCTCTGTCTACTGCAGCTTTACCGGTTTGCTTCTTCCGGTACTGCGTAGAACTCTTCAGAGGTGATTTCTTATCTTTGAG
ACAAGACAGTAAATCCGTAAATGGAAGGACCACGGAGGAAGAAATTCATCCAGCAAACGAAGGGTTGTCCATGGCCAGAA
AGTTTTGGGACATTCTCTGTGTCTGGATGGCCAGAGAAAGGTTTGTTTTTGCATTCAAGTGCTCAATTTCTCTTGGCCTT
GCGGTGCTGTTTGGTATACTGTATAATAAAAATAACGGGTATTGGTCGGGTCTAACTGTAGCCATTAGCCTTGTAAGCGG
TAGGCAAGCAACACTAACAGTAGCAAATTCTCGTCTACAAGGGACAGCCATGGGATCAGTCTACGGTCTAATATGTTGTT
CTGTTTTCCAAAGACTAGAAGAATTCAGGTTCTTACCTCTTCTCCCTTGGATAATCCTCGCCGTCTTCATGAGGCACAGC
AAAGTCTATGGCCAGCCTGGAGGAGTTACGGCTGCAATTGCTGCACTGTTGATACTTGGGAGGAGAAATTATGGAGCTCC
AACTGAATTTGCAATCGCTCGCATCGTTGAAGCTTCGATCGGGTTGCTCTGTTTTGTCTTCGGGGAGATTCTTGTCACCC
CTGCGAGAGCAGCAACGCTTGCAAGAACCGAAATTTCACACTGTCTCGATGCCCTCTTAGATTGCATCCAATCACTCGTT
CTTTGTTCTGAGCAGAAGAACCAGAAAGTGGTTGCAGATTTGAGAAAAAGTCAGGTAAAACTCAAATCTCATGTTGAAGC
ATTAGAGAGGTTTGCAGCAGAAGCCTTAACAGAGCCTAAGATTCCGTTCCTCCGCCGGCTCAACACGGACAGTTACAACA
GGCTTTTGGGCTCTTTCTCGAAGATATCTGATCTTTGTCTCTATGTTTGTGATGGCCTCAAAAATCTATCTGGAGTTCAA
CCAACACTTGCATTTCCTTGGGACAACATCACTCATGAGCTTAGAGCCTTCCAAGAAAAGCTTCACCCTTCGGTGAAATG
CTTAAAAGAGATTTCTCAAACCAAGTCTCAAGCAAGACTCCAAAAGGAGTTGCAGAAGAGAAAGATCTGCCATGATGTTG
AAGCAGGAACAACATCAAACGACAACTACTCATACATGGAGCTGGGTCCAAGCCAGGCTGATGTGGAGAGGTTTTCGGTT
TCTTTCGTCATGCTACTGAAGGAAGCAACAGACAAGATAAGTTGTAACACAGCAGACGATGCGTTCAAGAGTGAAACTGC
CCTATGTCTGAGCAGTCTAGGGTTCTGCATTAGCAGATTAATGCAGGAAACAATATGTATTATGACAGAAATAACCCATA
CAACTTGA