Details for Arabidopsis Locus AT3G09405

Position : Chr3 ( 5`- 2894812 .. 2897674 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09405

Protein [Map View]
MVIRSLLQCRTWSKSDWLLASIGIVLIVYSFSLSFNSTSDSIPSVDRSDLVKLKLSSKAKERGAFCLDGSLPGYHFHKGS
GSGSNSWLLYLEGGGGCRTIESCSARAMTRLGSSNFFEHEVPFFGVLSSDPSQNPDFFNWNRVMIRYCDGACFSGHPEAE
FKNETRLFFRGQLIWEAIMDELLSMGMSHAKRAMLTGCSAGGLSTLIHCDYFRDHLPKDATVKCVSDGGYILNVLDVLGN
PTMGSFFHDVVTLQSVDKSLDQNCVAKMEPSKCMFPQESLKNIRTPVFLVNTAYDYWQIQNGLVPDSPDLDERWKICRLN
IQECDAAQMKVLHGFRSSLIDAIGEFHVNKEGGMFINSCNSHCQIRESWHSATSTRIENKTIAESVGDWYFNRKPVKLID
CPYPCNASC*

DNA
ATGGTGATTCGCTCTCTGCTACAATGCAGAACATGGTCTAAGAGTGACTGGCTTCTCGCTTCAATCGGAATAGTCTTGAT
CGTTTATTCCTTTTCTTTGTCCTTCAATTCAACTTCAGACTCTATCCCCTCCGTTGACCGTAGCGATCTAGTTAAACTGA
AGCTGTCGAGTAAAGCTAAAGAGAGAGGAGCTTTTTGCTTAGATGGAAGCTTACCTGGTTATCACTTTCATAAGGGTTCA
GGATCTGGCTCCAATAGCTGGCTTCTTTATTTAGAGGGTGGAGGCGGGTGCCGTACAATTGAGTCATGTTCTGCTAGAGC
AATGACTAGGTTAGGTTCTTCCAACTTCTTTGAACATGAAGTGCCTTTTTTTGGCGTTTTAAGCAGTGACCCATCTCAAA
ACCCTGACTTCTTTAACTGGAACAGAGTTATGATACGGTACTGTGATGGTGCTTGTTTTTCTGGACACCCTGAAGCTGAA
TTCAAGAATGAAACACGGCTTTTCTTCCGCGGCCAGCTCATTTGGGAGGCTATCATGGATGAATTGTTGTCGATGGGCAT
GTCACATGCGAAACGTGCCATGCTCACAGGATGTTCTGCTGGTGGCTTGTCTACTCTAATACATTGTGACTACTTTCGAG
ACCATCTGCCTAAAGATGCAACTGTTAAATGTGTTTCCGATGGAGGCTATATTCTTAATGTGCTTGATGTCCTTGGAAAC
CCAACAATGGGATCTTTCTTTCATGATGTTGTTACCCTGCAGAGCGTAGATAAGAGCTTGGATCAGAATTGTGTTGCCAA
AATGGAACCATCTAAGTGTATGTTTCCTCAAGAATCTCTTAAAAACATAAGAACTCCGGTATTTCTTGTCAACACAGCCT
ACGATTATTGGCAGATTCAAAACGGCCTGGTACCAGATTCTCCGGATCTAGATGAAAGATGGAAAATTTGTAGACTCAAT
ATTCAGGAATGTGATGCCGCACAAATGAAAGTTCTGCATGGTTTCCGCAGTTCCCTGATCGATGCGATAGGAGAATTTCA
TGTGAACAAAGAGGGTGGGATGTTTATAAATTCGTGCAATTCTCATTGCCAGATAAGAGAGTCATGGCATTCCGCAACCT
CAACAAGAATCGAAAATAAGACGATTGCAGAGTCTGTAGGTGATTGGTACTTCAACCGAAAACCGGTGAAGCTAATCGAT
TGTCCTTATCCGTGCAATGCCTCTTGTTGA