Details for Arabidopsis Locus AT3G09400

Position : Chr3 ( 5`- 2891040 .. 2893629 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09400

Protein [Map View]
MGNGVASFSGCCAGTTAGEISGRYVTGVGLVQENLGHSFCYVRPVLTGSKSSFPPEPPLRPDPIPGTTTTFRSISGASVS
ANTSTALSTSLSTDTSGIASAFESSNRFASLPLQPVPRSPIKKSDHGSGLFERRFLSGPIESGLVSGKKTKEKAKLKKSG
SKSFTKPKLKKSESKIFTFKNVFTNLSCSKKSVIKPINGFDSFDGSSDTDRYIPEINSLSTIVSSHEKPRIKEEEDKTES
ALEEPKIQWAQGKAGEDRVHVILSEENGWLFVGIYDGFSGPDPPDYLIKNLYTAVLRELKGLLWIDKGESYNRNGESNIE
KQSTVEHASDSDQENCPVMNGNDVACGSRNITSDVKKLQWRCEWEHNSSNKSNNINHKDVLRALQQALEKTEESFDLMVN
ENPELALMGSCVLVTLMKGEDVYVMSVGDSRAVLARRPNVEKMKMQKELERVKEESPLETLFITERGLSLLVPVQLNKEH
STSVEEEVRRIKKEHPDDILAIENNRVKGYLKVTRAFGAGFLKQPKWNEALLEMFRIDYVGTSPYITCSPSLHHHRLSSR
DKFLILSSDGLYEYFSNEEAIFEVDSFISAFPEGDPAQHLIQEVLLRAAKKYGMDFHELLEIPQGDRRRYHDDVSVIVIS
LEGRIWRSSM*

DNA
ATGGGAAATGGAGTCGCGAGTTTTAGTGGCTGTTGCGCCGGAACCACCGCCGGAGAAATTTCCGGTCGATACGTAACCGG
AGTAGGACTGGTTCAAGAAAACCTCGGCCACTCTTTCTGCTACGTTCGTCCAGTTCTCACCGGATCAAAATCTTCTTTCC
CGCCGGAACCGCCCCTCCGACCCGACCCGATACCCGGAACCACCACCACTTTCCGATCAATCTCCGGCGCCTCTGTTAGC
GCCAATACTTCAACCGCGCTCTCAACTTCTCTGTCAACAGATACGTCTGGAATAGCCTCCGCGTTCGAGAGTTCCAATAG
ATTCGCTTCCTTGCCTCTCCAGCCTGTACCACGTAGTCCTATTAAGAAATCGGATCACGGGTCGGGTCTATTCGAACGCC
GGTTCTTATCCGGTCCGATTGAAAGCGGTTTGGTTTCAGGGAAGAAGACCAAGGAGAAAGCAAAACTGAAGAAAAGTGGA
AGCAAATCCTTTACGAAACCAAAACTGAAGAAAAGTGAAAGCAAAATCTTTACATTCAAAAACGTTTTCACCAACTTATC
TTGTTCGAAGAAGAGTGTGATTAAGCCAATCAACGGTTTCGATTCATTCGATGGATCATCAGATACTGATCGTTACATAC
CTGAGATCAACTCCTTAAGCACGATTGTGAGCAGCCATGAGAAACCTAGAATCAAAGAAGAAGAAGATAAGACTGAGTCT
GCTTTAGAGGAGCCAAAGATACAATGGGCACAGGGGAAAGCAGGTGAAGATCGAGTACACGTCATCCTCTCCGAGGAAAA
CGGTTGGCTTTTCGTCGGAATTTACGACGGATTCAGCGGTCCAGATCCACCGGATTATCTTATCAAAAATCTCTACACTG
CCGTGCTCAGAGAGCTCAAAGGGTTACTATGGATCGACAAAGGTGAATCATATAATAGAAACGGCGAGTCCAACATCGAG
AAACAGAGTACAGTCGAGCATGCATCCGATTCGGATCAAGAAAACTGCCCTGTGATGAATGGAAACGATGTTGCTTGTGG
ATCAAGAAACATTACGAGTGACGTGAAGAAGTTGCAATGGAGGTGCGAGTGGGAGCATAACTCAAGCAACAAGTCTAATA
ATATTAACCACAAAGACGTTCTTAGAGCTCTTCAACAAGCGTTGGAGAAAACAGAAGAATCGTTTGATCTGATGGTTAAT
GAGAATCCAGAATTAGCCTTGATGGGATCCTGCGTTCTTGTGACATTGATGAAAGGAGAAGATGTTTACGTGATGAGCGT
TGGAGATAGCCGAGCGGTTCTTGCTCGAAGACCTAATGTCGAGAAAATGAAGATGCAAAAGGAGCTTGAGAGAGTCAAAG
AAGAAAGTCCATTAGAGACCTTGTTCATCACCGAAAGAGGACTGAGTCTTCTGGTCCCTGTTCAGCTCAATAAGGAACAT
AGCACAAGTGTTGAAGAGGAAGTGAGAAGAATCAAGAAGGAACATCCTGATGATATATTAGCGATAGAGAATAATAGAGT
GAAAGGTTATCTCAAAGTCACTCGTGCATTTGGCGCTGGATTTCTTAAACAGCCAAAATGGAACGAGGCGCTTCTAGAGA
TGTTCAGAATAGACTACGTCGGAACATCGCCGTACATCACGTGCTCTCCGTCGCTACACCACCATAGACTCTCATCACGT
GACAAATTCCTAATCCTCTCATCCGATGGACTATACGAATACTTCTCGAACGAGGAAGCCATCTTCGAGGTTGACTCATT
CATCTCAGCCTTCCCTGAAGGCGATCCTGCTCAACATCTCATTCAAGAAGTCCTCCTTAGAGCTGCCAAGAAATATGGTA
TGGACTTTCATGAATTGCTAGAGATACCACAAGGAGATCGTCGGAGGTATCATGACGATGTTTCTGTGATTGTGATTTCA
CTTGAAGGAAGAATTTGGAGATCTTCCATGTGA