Details for Arabidopsis Locus AT3G09390

Position : Chr3 ( 5`- 2889486 .. 2890229 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09390

Protein [Map View]
MSCCGGNCGCGSGCKCGNGCGGCKMYPDLGFSGETTTTETFVLGVAPAMKNQYEASGESNNAENDACKCGSDCKCDPCTC
K*

DNA
ATGTCTTGCTGTGGAGGAAACTGCGGATGTGGATCTGGCTGCAAGTGCGGCAACGGTTGTGGAGGTTGCAAAATGTACCC
TGACTTGGGATTCTCCGGCGAGACAACCACAACTGAGACTTTTGTCTTGGGCGTTGCACCGGCGATGAAGAATCAGTACG
AGGCTTCAGGGGAGAGTAACAACGCTGAGAACGATGCTTGCAAGTGTGGATCTGACTGCAAGTGTGATCCTTGCACCTGC
AAGTGA