Details for Arabidopsis Locus AT3G09310

Position : Chr3 ( 5`- 2860402 .. 2861359 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09310

Protein [Map View]
MAVVISIHRPYVTLTISKNRNPLKPHRQFNESCLRFDHLPRNTKNQLRCLSAKSTPSKPDPASPQDGEELESVGVKAALA
MLRFYKREISPVLPRSCRYVPTCSEYSMEAYKKYGVLKGTVLTTWRLCRCNPLGGSGFDPPRWFGESGIKLREGDEEEED
NYDDEDQRKI*

DNA
ATGGCGGTCGTCATCTCCATCCATCGTCCTTATGTAACCCTCACAATCTCTAAAAATCGTAATCCTCTTAAACCTCACCG
ACAATTCAACGAATCCTGCCTGAGGTTTGATCATCTTCCTCGGAACACCAAAAATCAGCTCCGTTGCTTATCTGCGAAAT
CGACGCCATCGAAACCAGACCCTGCATCCCCTCAAGATGGGGAAGAGCTGGAGAGTGTGGGAGTCAAAGCAGCTTTAGCA
ATGCTGAGATTCTACAAGAGAGAGATATCGCCGGTGTTACCTAGAAGCTGCCGTTACGTTCCGACTTGCAGTGAATACTC
AATGGAAGCTTACAAGAAATATGGAGTTCTTAAAGGCACTGTTCTCACAACTTGGCGTCTCTGTCGCTGCAATCCTCTTG
GTGGATCTGGGTTCGATCCTCCAAGATGGTTTGGTGAGAGTGGGATCAAGCTCCGAGAAGGAGACGAAGAAGAAGAAGAT
AACTATGACGACGAAGATCAAAGAAAGATTTGA