Details for Arabidopsis Locus AT3G09300

Position : Chr3 ( 5`- 2857847 .. 2860668 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09300

Protein [Map View]
MAPNDPKKAVGGGGSGFFASLASSISNLGSAMTKSVNGLVPYEGLEVINPEGSTDDAEEEASRGRWKQEDRDGYWKMMQK
YIGSDVTSMVTLPVIIFEPMTMLQKMAELMEYSHLLDMADKTEDPYLRMVYASSWAISVYYAFQRTWKPFNPILGETYEM
ANYNGVNFISEQVSHHPPMSAGHAENEHFTYDCTSKLKTKFLGNSIDVYPVGRTRVTLKRDGVVLDLVPPLTKVHNLIFG
RTWVDSPGEMIMTNQTTGDKVVLYFQPCGWFGSGRYEVDGYVYNASEEPKILMTGKWNESMSYQPCDGEGEPLPGTELKE
VWKLADVPKDDKYQYTHFAHKINSFDTAPKKLLPSDSRLRPDRYALEMGDMSKSGYEKSSMEERQRAEKRTREEKGQAFT
PKWFDVTEEVTATPWGDLEVYQFNGKYSEHRAAADNSEDNTDPKSIQFNPWQFQDLST*

DNA
ATGGCTCCTAATGATCCTAAAAAAGCCGTTGGTGGCGGCGGAAGTGGTTTCTTCGCCTCTCTTGCTTCGTCGATCTCCAA
TTTGGGATCTGCTATGACCAAATCAGTTAATGGTTTGGTTCCCTATGAGGGACTTGAAGTTATCAATCCTGAAGGAAGTA
CAGATGATGCTGAGGAGGAAGCAAGCAGAGGAAGATGGAAGCAAGAGGATCGAGATGGCTATTGGAAGATGATGCAGAAG
TACATAGGATCTGATGTTACATCAATGGTGACCCTTCCTGTGATTATTTTTGAACCAATGACAATGCTTCAGAAAATGGC
GGAGTTGATGGAATACTCGCATCTGCTAGACATGGCAGACAAAACCGAGGACCCTTATTTGCGCATGGTGTATGCATCAT
CGTGGGCTATATCCGTGTATTATGCTTTCCAACGTACCTGGAAACCATTCAATCCAATCCTTGGTGAGACTTATGAGATG
GCTAATTACAATGGTGTTAACTTCATATCTGAACAGGTCAGCCATCACCCACCAATGAGTGCTGGTCATGCTGAAAATGA
GCATTTTACGTATGATTGTACTTCAAAACTGAAAACAAAATTTTTGGGCAATTCCATTGACGTTTACCCAGTAGGAAGGA
CACGGGTGACACTTAAAAGAGATGGAGTTGTTCTTGACTTGGTACCTCCTCTGACCAAAGTTCACAACCTAATCTTTGGA
CGAACTTGGGTCGATTCGCCTGGGGAAATGATCATGACAAATCAGACCACCGGTGACAAAGTCGTGCTTTACTTTCAACC
ATGTGGCTGGTTCGGATCTGGTCGATATGAAGTGGATGGATATGTCTATAACGCCTCTGAGGAGCCTAAGATACTCATGA
CTGGCAAATGGAACGAGTCCATGAGTTATCAGCCGTGTGATGGTGAAGGTGAACCTCTCCCAGGCACCGAACTGAAAGAG
GTATGGAAACTCGCTGATGTGCCAAAGGATGACAAATATCAATACACTCACTTTGCTCACAAGATTAATAGCTTCGACAC
TGCCCCGAAAAAGCTGTTGCCCTCTGATTCACGGTTACGACCTGATAGATACGCACTTGAGATGGGCGACATGTCCAAAT
CAGGCTATGAGAAGAGCAGCATGGAAGAGAGACAGAGAGCTGAAAAGAGAACCCGCGAAGAGAAAGGCCAAGCCTTTACT
CCAAAATGGTTCGATGTAACGGAAGAAGTCACTGCTACACCATGGGGTGATCTGGAAGTTTACCAATTCAATGGAAAGTA
CTCGGAACATCGTGCAGCTGCGGATAACTCTGAAGATAACACCGACCCTAAGTCGATCCAATTCAACCCATGGCAATTCC
AAGATCTGTCTACTTAA