Details for Arabidopsis Locus AT3G09290

Position : Chr3 ( 5`- 2856141 .. 2856659 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09290

Protein [Map View]
MENIKNPKNADDCSDSISKNSHQGVDDSLNQSRSYVCSFCIRGFSNAQALGGHMNIHRRDRAKLRQKLMEDNKDDVVAES
DASEVVSLDLNEQQQQQGEALTCDDHDQYVDNDISPKQKLEFWVQESKLDTNDHGKVTEASIDGSSSSHHRDIEVLDLEL
RLGQSVVKKKTT*

DNA
ATGGAAAACATCAAAAACCCTAAAAACGCAGATGATTGTTCCGATAGCATATCAAAAAACAGTCATCAAGGCGTTGATGA
TTCCCTGAACCAGTCAAGATCTTACGTATGCAGTTTCTGCATAAGGGGCTTCTCGAATGCTCAAGCACTAGGAGGGCATA
TGAACATCCACAGAAGAGACAGGGCTAAACTCAGACAAAAGCTTATGGAAGATAATAAGGATGATGTCGTCGCCGAGAGT
GATGCATCCGAAGTTGTGTCTCTAGACCTTAATGAACAACAACAACAACAAGGAGAAGCTTTGACATGTGATGATCACGA
TCAATATGTTGATAACGATATAAGTCCTAAACAGAAATTAGAGTTTTGGGTTCAAGAAAGCAAGCTTGATACTAATGATC
ATGGAAAGGTCACGGAGGCTAGCATAGATGGTTCGAGTTCGAGTCATCATCGTGATATTGAAGTATTGGATCTCGAGCTT
CGGTTAGGCCAAAGCGTCGTAAAGAAGAAGACAACATAG