Details for Arabidopsis Locus AT3G09280

Position : Chr3 ( 5`- 2850920 .. 2851258 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09280

Protein [Map View]
MDAKHIVLCFLLTYVFSMAAASSEAEPPATRKLGRHEWPGEEAEAPEVSHLEETVRRGHHHSTVERSVAGGGVILGGLAT
TFLVVVFCYIRATRKHKPNYDEKETETPKVLV*

DNA
ATGGATGCGAAACATATAGTTCTATGCTTCTTGCTAACGTACGTCTTCTCCATGGCGGCAGCCTCATCGGAAGCTGAGCC
TCCGGCAACAAGGAAACTCGGCAGGCACGAATGGCCAGGAGAGGAGGCAGAAGCACCGGAGGTTTCACATTTGGAAGAGA
CTGTACGGCGAGGCCACCACCATTCCACGGTGGAAAGATCGGTTGCCGGAGGTGGAGTTATTCTCGGAGGCTTAGCTACA
ACGTTTCTTGTGGTAGTGTTTTGCTATATAAGGGCTACGAGGAAACACAAACCCAATTATGATGAAAAGGAGACTGAGAC
CCCTAAAGTGTTAGTTTAA