Details for Arabidopsis Locus AT3G09250

Position : Chr3 ( 5`- 2839000 .. 2840614 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09250

Protein [Map View]
MVEITSPFGGSMRLLHLPKSYPIHCNMVSASNTFGSAHLKLQNKEPCSRLRPCRVKREENNQTADVESISMDENTLKQDL
ETAVQEENYVEAAKIRDKLKELQEDNKASVLSANSRFYQSFRNGDLAAMQSLWSKSGNPCCVHPGAKGITGYDYVMESWE
LVWMNYEFPLLIELKDVEVHVRGEVGYVTCMEFVKTKGSSSWGAQFVSNVFERIDGQWLRWDTLVVCLRVMKDCFLFLRR
KINSFY*

DNA
ATGGTAGAGATCACTTCTCCGTTTGGTGGTTCCATGAGGCTGCTTCACTTGCCTAAATCTTATCCGATTCACTGCAACAT
GGTTTCAGCTAGCAATACATTTGGGTCAGCTCATCTCAAGCTGCAAAACAAAGAACCGTGCTCCCGTTTAAGGCCTTGTC
GAGTCAAACGCGAAGAAAATAACCAAACTGCGGATGTTGAAAGCATTTCAATGGATGAGAACACGTTGAAGCAAGATCTC
GAGACTGCGGTCCAGGAAGAGAATTATGTGGAGGCAGCTAAAATCCGTGATAAACTAAAAGAGCTTCAAGAAGACAACAA
AGCCTCTGTTTTATCAGCCAATTCTCGGTTCTACCAATCTTTCAGAAACGGGGATTTAGCTGCGATGCAATCACTATGGT
CAAAATCAGGAAACCCGTGCTGTGTACATCCAGGGGCCAAAGGCATAACTGGTTATGATTACGTGATGGAAAGCTGGGAG
CTTGTGTGGATGAACTATGAGTTTCCGTTACTGATTGAGCTGAAAGATGTCGAGGTTCATGTCCGAGGAGAAGTAGGTTA
TGTAACGTGTATGGAGTTTGTGAAGACGAAAGGGAGTAGTAGTTGGGGAGCTCAGTTTGTGTCGAATGTGTTTGAACGGA
TCGATGGACAATGGTTGCGGTGGGATACATTGGTGGTTTGCTTAAGGGTGATGAAGGACTGTTTTTTATTTCTGAGAAGA
AAAATAAACTCTTTTTATTAG