Details for Arabidopsis Locus AT3G09240

Position : Chr3 ( 5`- 2835668 .. 2837956 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09240

Protein [Map View]
MIERTNLIVLAADNKEEDEGSTCPNFLEFSLEQLRVATDGFSADNIVSEHNERVPNIVYKGQLNDGRKIAVKRFQRLSWP
DSLEFIEEAQAVGRCRSEHMANLIGCCSEGHERLLVAEYMPNETLAKHLFHWEKRPMKWEMRLRVALHTATALEYCNDWG
IDLYHDLNTYRILFDKVGNPRLSCFGLMKCSREGKSYSTNLAFAPPEYLRLGTVIPESVTFSFGTLLLDLMSGRHIPPNH
ALDLFRGKNYLVLMDSALDGQFSDEDRTELIHLASRCLRPEPDERPSIKFLMSALSRLEKRAELWPNVKEENIPTPSYTE
PATKEPLPLTPFGEACWRVDLSGMHELLEKLGYGEDDVVVTNEFSFQMWTGQMQENMDYKKHGDAAFRAKDFETAIEFYT
EFMSGAPVVSPTVLARRCLCYLMSDMFREALSDAMQTQVASPEFSIALYLQAACLLKLGMEAEAKEALRHGSSLEAF*

DNA
ATGATCGAGAGAACTAACCTAATAGTTTTGGCTGCAGATAATAAAGAAGAAGATGAAGGAAGTACTTGTCCTAATTTCCT
GGAGTTCAGCTTGGAACAGTTGAGAGTCGCAACTGACGGATTCTCCGCCGACAACATCGTGTCGGAGCACAACGAGAGGG
TTCCTAACATCGTCTACAAAGGCCAGCTCAACGACGGAAGAAAGATCGCCGTCAAGCGGTTTCAACGGCTTTCATGGCCT
GATTCTTTAGAATTCATCGAGGAAGCACAAGCTGTAGGGAGATGTAGGAGTGAGCATATGGCCAATTTGATCGGTTGTTG
CTCAGAAGGTCACGAGAGGTTGCTTGTTGCTGAGTACATGCCTAATGAAACACTTGCTAAGCATCTCTTTCACTGGGAGA
AAAGACCAATGAAGTGGGAAATGAGGTTGAGAGTTGCGTTACATACTGCAACAGCCTTGGAGTACTGTAATGATTGGGGA
ATAGATTTGTATCACGATCTTAACACCTACAGAATATTGTTTGACAAGGTTGGGAATCCTAGGCTGTCTTGTTTTGGTCT
CATGAAGTGTAGCCGAGAGGGAAAGAGCTATAGTACCAACTTGGCATTTGCTCCTCCTGAATATTTACGTCTAGGTACTG
TGATACCGGAGAGTGTCACATTTAGCTTCGGAACCTTGTTACTGGATCTTATGAGCGGCAGACATATTCCACCAAACCAT
GCACTTGATCTGTTCCGTGGTAAAAACTATTTGGTGCTAATGGATTCAGCTCTGGATGGTCAATTCTCTGATGAGGATAG
AACAGAACTTATCCATCTAGCTTCCCGCTGTTTGCGCCCTGAACCAGACGAGAGGCCAAGCATAAAGTTTCTTATGTCAG
CTCTTTCAAGACTTGAGAAAAGAGCTGAGTTATGGCCCAACGTCAAAGAAGAAAACATCCCTACTCCATCATACACTGAA
CCTGCAACAAAGGAGCCATTGCCCTTGACCCCTTTCGGAGAAGCATGCTGGAGAGTGGATCTAAGTGGTATGCACGAACT
ACTCGAGAAACTCGGGTATGGAGAGGATGATGTGGTGGTCACAAATGAGTTCTCATTCCAAATGTGGACGGGTCAAATGC
AAGAGAATATGGATTACAAGAAGCACGGAGATGCCGCATTTCGTGCTAAAGATTTTGAAACCGCAATCGAATTCTACACA
GAGTTCATGAGTGGAGCACCAGTGGTATCACCAACAGTATTAGCCAGACGGTGTCTATGTTACCTAATGAGTGATATGTT
CCGCGAGGCTCTAAGTGATGCGATGCAAACTCAGGTCGCATCGCCAGAGTTTTCGATCGCTCTCTACTTACAAGCAGCTT
GTCTTTTAAAGCTTGGGATGGAGGCTGAAGCTAAAGAAGCTCTTAGACATGGCTCTTCTCTCGAAGCTTTTTAG