Details for Arabidopsis Locus AT3G09220

Position : Chr3 ( 5`- 2827239 .. 2830542 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09220

Protein [Map View]
MEGVRVPIACALILLAISSITSASIVEHTFNVQNLTVSRLCKRQVITVVNGSLPGPTIRVKEGDSLVIHVLNHSPHNITI
HWHGIFHKLTVWADGPSMITQCPIQPGQRYAYRFNITGQEGTLWWHAHASFLRATVYGALVIRPKSGHSYPFPKPHKEVP
ILFGEWWNTDVVALEEAAIATGVPPNNSDAYTINGRPGNLYPCSKDRMFSLNVVKGKRYLLRIINAAMNIQLFFKIANHR
LTVVAADAVYTAPYVTDVIVIAPGQTIDALLFADQSVDTSYYMAAHPYASAPAVPFPNTTTRGVIHYGGASKTGRSKPVL
MPKLPSFFDTLTAYRFYSNLTALVNGPHWVPVPRYVDEEMLVTIGLGLEACADNTTCPKFSASMSNHSFVLPKKLSILEA
VFHDVKGIFTADFPDQPPVKFDYTNPNVTQTNPGLLFTQKSTSAKILKFNTTVEVVLQNHALIAAESHPMHLHGFNFHVL
AQGFGNYDPSRDRSKLNLVDPQSRNTLAVPVGGWAVIRFTANNPGAWIFHCHIDVHLPFGLGMIFVVKNGPTKSTTLPPP
PPDLPKC*

DNA
ATGGAGGGAGTTAGGGTTCCTATTGCTTGCGCTCTAATTCTTCTCGCAATCTCTTCCATAACTTCTGCCTCCATTGTGGA
ACACACCTTCAACGTACAAAACTTAACGGTGTCTAGGCTGTGCAAACGGCAAGTGATAACGGTCGTTAACGGAAGCCTGC
CTGGACCAACAATACGCGTCAAGGAGGGTGACTCGCTCGTTATTCACGTTCTAAACCATTCCCCTCACAACATCACAATT
CATTGGCATGGGATCTTCCATAAACTAACGGTTTGGGCAGATGGACCGAGTATGATAACGCAGTGCCCAATCCAGCCTGG
CCAAAGATACGCTTACAGATTCAACATCACCGGCCAAGAAGGCACCTTGTGGTGGCATGCACACGCGTCTTTCCTACGCG
CCACCGTATACGGTGCTCTCGTCATCCGCCCTAAATCTGGTCACTCTTACCCGTTTCCCAAACCTCACAAAGAAGTTCCC
ATCTTATTTGGTGAATGGTGGAACACCGATGTAGTCGCGTTAGAGGAGGCAGCAATCGCCACCGGAGTTCCTCCAAACAA
TTCCGACGCTTATACGATCAATGGCCGTCCCGGAAACCTATATCCATGCTCCAAAGACAGAATGTTTAGCCTAAACGTGG
TGAAAGGAAAGAGATACTTACTTCGCATCATAAACGCGGCCATGAACATCCAACTGTTTTTCAAGATAGCCAATCACAGA
CTGACAGTTGTAGCCGCCGACGCAGTCTACACCGCACCTTACGTCACCGACGTCATTGTCATCGCACCGGGCCAAACCAT
CGACGCCCTTCTCTTCGCCGATCAGTCCGTCGATACCTCCTACTACATGGCAGCTCACCCTTACGCCAGCGCTCCCGCCG
TCCCTTTCCCAAACACCACCACCAGAGGCGTCATTCACTATGGCGGCGCGTCGAAAACAGGGCGATCAAAGCCCGTGTTG
ATGCCGAAACTACCTTCCTTCTTCGACACGTTAACGGCTTACAGATTCTACTCCAACCTCACTGCCTTAGTCAATGGACC
TCACTGGGTTCCAGTTCCACGCTACGTGGACGAAGAGATGCTCGTAACCATCGGTCTTGGGCTAGAGGCATGCGCAGATA
ACACCACGTGTCCAAAATTCTCAGCTTCTATGAGCAATCACTCTTTCGTGTTACCCAAGAAGCTATCGATCTTGGAAGCA
GTGTTTCACGACGTTAAAGGGATTTTCACCGCGGATTTTCCAGACCAGCCTCCGGTTAAGTTTGATTACACGAACCCGAA
CGTAACCCAAACAAACCCGGGACTTTTGTTCACTCAAAAATCAACTAGCGCCAAGATTTTGAAATTCAATACGACGGTGG
AGGTAGTGTTACAGAACCATGCGCTTATAGCGGCGGAGAGTCATCCCATGCATCTACATGGATTTAATTTCCATGTATTG
GCTCAAGGGTTTGGTAATTATGACCCGAGCCGTGACCGGAGCAAGTTAAATCTCGTTGACCCGCAATCCCGTAACACTTT
GGCTGTCCCTGTTGGTGGATGGGCTGTGATCCGTTTCACTGCTAATAATCCAGGTGCGTGGATTTTTCATTGTCATATCG
ATGTTCACTTACCATTCGGACTAGGGATGATATTTGTGGTTAAGAACGGACCGACCAAGTCGACCACCTTGCCACCGCCA
CCACCAGATCTTCCCAAATGTTAA