Details for Arabidopsis Locus AT3G09210

Position : Chr3 ( 5`- 2825279 .. 2826880 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09210

Protein [Map View]
MMKLQGGLLQWSRSSLIPSIYTPINKTQFSIAACVIERNHQLTAKERRQLRNERRESKLGYSWREEVEEKLIKKPKKRYA
TWTEELNLDTLAESGPQWWAVRVSRLRGHETAQILARALARQFPEMEFTVYAPSVQVKRKLKNGSISVKPKPVFPGCIFI
RCILNKEIHDSIRDVDGVGGFIGSKVGNTKRQINKPRPVDDSDLEAIFKQAKEAQEKADSEFEEADRAEEEASILASQEL
LALSNSDVIETVAESKPKRAPRKATLATETKAKKKKLAAGSTVRVLSGTFAEFVGNLKKLNRKTAKATVGFTLFGKETLV
EIDINELVPEIQS*

DNA
ATGATGAAGCTGCAAGGGGGACTTCTCCAGTGGAGTCGTAGCAGCTTAATCCCGTCGATTTATACGCCAATCAACAAAAC
CCAATTCTCTATCGCCGCCTGTGTCATCGAGCGGAACCACCAGCTTACGGCGAAGGAGAGACGGCAGCTCCGGAACGAGC
GGCGGGAGAGTAAATTGGGGTATAGCTGGCGAGAAGAAGTTGAAGAAAAGTTGATTAAGAAACCAAAAAAACGGTATGCA
ACGTGGACGGAGGAGCTGAATTTGGATACTTTGGCTGAGTCGGGTCCGCAATGGTGGGCGGTTAGGGTTTCGAGACTTCG
TGGTCATGAGACTGCTCAAATCTTAGCTCGAGCTCTGGCTCGTCAATTCCCTGAAATGGAATTCACGGTTTATGCACCAT
CTGTTCAAGTGAAGAGAAAGCTAAAGAACGGTTCTATATCTGTTAAACCGAAACCAGTGTTCCCTGGTTGCATTTTCATC
AGATGTATATTGAACAAAGAGATACATGACTCCATAAGAGACGTTGATGGAGTCGGAGGTTTCATAGGTTCAAAAGTTGG
AAATACCAAGAGACAGATTAATAAACCAAGACCAGTAGATGACAGTGACTTGGAAGCTATTTTCAAACAAGCAAAAGAAG
CGCAAGAGAAAGCAGATAGTGAGTTCGAAGAGGCAGATAGAGCTGAAGAAGAAGCGAGTATACTAGCGTCACAGGAACTT
CTCGCATTATCTAATTCAGATGTTATTGAGACTGTAGCAGAATCTAAACCGAAACGAGCCCCGAGAAAAGCTACACTTGC
TACTGAAACAAAGGCGAAGAAGAAGAAACTTGCAGCGGGTTCTACAGTTAGAGTTTTATCAGGGACATTTGCTGAATTTG
TTGGGAACCTAAAGAAACTAAACCGCAAAACTGCAAAGGCAACGGTGGGATTTACTTTGTTTGGGAAGGAGACACTAGTG
GAAATTGACATCAATGAACTTGTTCCTGAGATTCAATCTTAA