Details for Arabidopsis Locus AT3G09200

Position : Chr3 ( 5`- 2823090 .. 2825114 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09200

Protein [Map View]
MVKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMMKRSVRIHSENTGNTAILNL
LPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPV
ELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAAP
HMFINAYKNALAIAVATEYTFPQAEKVKEYLKDPSKFAVASVAAVSADAGGGAPAAAKVEEKEESDEEDYGGDFGLFDEE
*

DNA
ATGGTGAAAGCAACTAAGGCAGAGAAGAAGATCGCCTACGATACCAAGCTATGTCAGCTTATCGATGAGTACACCCAGAT
CTTGGTCGTTGCGGCCGATAACGTCGGATCAACTCAGCTTCAGAACATCAGAAAGGGTCTTCGTGGAGACTCCGTCGTGC
TTATGGGGAAGAACACTATGATGAAGCGTTCCGTTAGGATTCACTCTGAGAACACCGGAAACACTGCAATCCTGAATCTG
CTTCCTCTCCTTCAGGGAAACGTTGGTTTGATCTTTACCAAAGGTGACCTCAAGGAAGTGAGCGAGGAGGTTGCTAAGTA
CAAGGTTGGTGCCCCTGCTCGTGTGGGTTTGGTGGCTCCAATTGATGTGGTTGTCCAACCTGGCAACACTGGTCTCGACC
CATCCCAAACATCTTTCTTCCAGGTGCTTAACATCCCAACCAAGATTAACAAGGGTACCGTCGAAATCATCACCCCAGTT
GAGCTTATCAAGCAAGGTGACAAGGTCGGGTCTTCTGAGGCTGCGCTTCTAGCCAAGCTTGGCATCAGGCCGTTCTCATA
TGGTCTTGTTGTCCAGTCTGTCTATGACAATGGCTCAGTCTTCAGCCCAGAGGTTCTTGATCTTACTGAAGACCAACTTG
TGGAGAAGTTTGCTTCTGGTATCTCCATGGTCACTTCCTTGGCTCTTGCTGTGTCGTACCCTACCCTTGCTGCTGCACCG
CATATGTTCATCAATGCGTACAAGAATGCCTTGGCTATTGCTGTTGCCACTGAGTACACCTTCCCTCAAGCAGAGAAGGT
CAAGGAATACTTGAAGGATCCAAGCAAGTTTGCTGTTGCTTCAGTAGCTGCGGTGTCTGCTGATGCAGGTGGTGGTGCCC
CAGCTGCTGCTAAGGTAGAGGAGAAGGAAGAGTCCGACGAAGAAGACTATGGAGGTGATTTCGGTTTGTTCGATGAAGAG
TAG