Details for Arabidopsis Locus AT3G09180

Position : Chr3 ( 5`- 2819118 .. 2821425 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09180

Protein [Map View]
MQTLHQSQLLQNPAEAANNQSESDAPPKQVAQAMERLNQAARVIADIRLGADRILEAMFVASQPRHTDMPLQLFLREDAS
MRQHLQDLRLIGKKLEESGVLTESLRSRSNSWGLHMPLVCPDGAVVAYAWKRQLAGQAGASAVDRTRLALKAFTDQKRRF
FPHIDDGLKMEPSSKKHRASHLLLENGREEPVDYKTLPDIQSRLEKLVPSVKVSTYGRLNWLKRANSLPGSGSDDPTEAS
KPIFQSSSKLRSGLQTEVVDKIAVIELSFPSLFRAIVSLSPAGSVDPDAVAFFSPDEGGSYLHARGFSVYHVYKHITEHA
ATALQYFLGFGTGTALYSLLLWICSFESVFSKPCTKCGRLLAMDKKSALILPPLHRAYQELPLALNLDVCEAYHSSCSQD
DT*

DNA
ATGCAGACGCTACACCAGTCCCAACTTCTCCAGAATCCGGCCGAGGCGGCGAACAATCAGTCTGAATCGGACGCGCCGCC
GAAACAGGTGGCTCAGGCCATGGAACGACTCAATCAAGCGGCTAGGGTTATCGCCGATATCCGCCTCGGCGCTGACCGTA
TCCTTGAAGCTATGTTCGTGGCTTCGCAACCTCGTCACACAGACATGCCTCTTCAGCTCTTTCTCAGAGAAGACGCCTCC
ATGCGTCAACATCTTCAGGATCTTCGCTTAATAGGGAAGAAATTGGAAGAATCTGGAGTGTTAACTGAATCACTTAGGTC
AAGAAGTAACTCTTGGGGTCTTCACATGCCTTTGGTTTGTCCAGATGGTGCAGTCGTTGCTTATGCTTGGAAAAGACAGC
TTGCTGGCCAAGCTGGTGCTTCTGCTGTTGATAGAACCAGGTTAGCTCTCAAGGCCTTCACGGATCAGAAAAGACGATTC
TTCCCTCATATTGATGATGGATTAAAGATGGAACCAAGCTCAAAAAAACATCGTGCCTCCCATTTGCTATTAGAAAATGG
AAGAGAGGAGCCGGTTGATTACAAAACATTGCCAGATATACAATCGCGTTTAGAGAAGCTGGTTCCGAGTGTGAAGGTGT
CTACTTATGGACGATTGAACTGGCTTAAAAGAGCTAACTCTTTACCTGGGTCAGGTAGTGATGATCCTACAGAAGCATCG
AAACCTATTTTCCAGAGTTCTAGCAAGCTGAGATCAGGGTTACAGACTGAAGTTGTCGACAAGATTGCTGTTATTGAGTT
ATCATTTCCTTCTCTATTCAGAGCTATAGTCTCGTTGAGTCCAGCGGGTTCTGTTGATCCAGATGCAGTTGCTTTCTTCT
CCCCAGATGAGGGAGGCAGCTACTTACATGCGAGAGGCTTCTCGGTTTATCATGTTTACAAACACATAACGGAACATGCT
GCTACAGCCTTGCAATATTTCCTCGGCTTTGGTACTGGAACAGCTCTCTACTCTCTTCTGCTATGGATATGCAGTTTTGA
ATCCGTATTTAGCAAACCTTGCACTAAATGTGGAAGGCTATTAGCAATGGATAAAAAGTCTGCGTTAATCTTACCTCCTT
TACACCGCGCTTACCAAGAATTGCCTCTTGCATTAAACCTGGACGTTTGTGAAGCTTACCACTCCAGTTGCTCTCAAGAT
GATACCTAG