Details for Arabidopsis Locus AT3G09150

Position : Chr3 ( 5`- 2803528 .. 2805588 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09150

Protein [Map View]
MALSMEFGFSIGSCFKAPNPPVLISASPNKINFTLRRRKKRFLLRVSAVSYKEFAESALEETRKRIVLEPSHLQEKYSSM
TGLDGKTELQMLAFKSSKIRLLRSMAIENETMQVFDFAGFMEPEYDTPIFCANFFTSTNVNIVVLDLNPLHQLTDQTDYQ
DKYYNKIMSIYHKYAETFPWGGKLTGESIKFFSPLVMWTRFSSSKEKHKALFSAFLEYYQAWLEMTIQVREEMEPSHVRA
NCEAQHKYLTWRAQKDPGHGLLKRLVGEAKAKELLRDFLFNGVDELGTKTFIDYFPEYQTEDGTVSDKRSIIGKSYETRP
WDLTGQFIG*

DNA
ATGGCTTTATCAATGGAGTTTGGGTTTTCAATTGGGTCATGCTTCAAGGCACCAAACCCACCTGTTCTAATCTCTGCAAG
CCCTAATAAGATCAATTTCACGTTGAGAAGGAGAAAGAAAAGATTCTTACTTAGAGTCTCTGCTGTGTCGTATAAGGAAT
TCGCAGAGTCTGCTTTAGAAGAAACCAGGAAAAGGATCGTTCTTGAACCTTCACATCTCCAGGAAAAGTATAGTAGCATG
ACAGGACTAGATGGTAAGACCGAACTTCAAATGCTTGCTTTTAAATCTTCAAAGATTAGACTCTTGAGGAGTATGGCAAT
AGAGAATGAGACAATGCAGGTCTTTGACTTTGCGGGTTTCATGGAGCCTGAGTATGATACTCCCATATTCTGTGCTAACT
TTTTCACATCTACCAACGTTAACATAGTTGTATTGGACCTTAATCCTTTGCATCAGTTGACTGACCAGACGGATTACCAA
GACAAGTATTATAACAAGATAATGTCCATATATCACAAATATGCTGAGACTTTCCCATGGGGAGGGAAATTGACTGGTGA
ATCCATAAAGTTTTTCTCGCCTTTGGTGATGTGGACTAGGTTTTCGTCTAGCAAAGAAAAACATAAGGCTTTGTTCTCTG
CGTTTCTAGAGTACTATCAGGCATGGCTTGAGATGACAATCCAAGTGAGGGAGGAGATGGAACCATCTCATGTGAGAGCC
AATTGTGAAGCACAACACAAGTACCTGACATGGCGAGCACAAAAGGATCCTGGACATGGTCTTCTTAAAAGATTAGTAGG
TGAAGCAAAGGCAAAGGAGCTGCTAAGGGATTTCCTGTTCAATGGGGTGGATGAGTTAGGCACAAAAACATTCATTGATT
ACTTTCCAGAGTACCAAACAGAAGATGGAACTGTAAGCGATAAACGAAGTATCATTGGGAAGTCATATGAAACTCGTCCA
TGGGATTTAACAGGACAATTTATCGGCTAA