Details for Arabidopsis Locus AT3G09110

Position : Chr3 ( 5`- 2794165 .. 2795991 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09110

Protein [Map View]
MAKSFEKPKFSLRLLIDEEKNRVILAEAGKDFVDVLCSLLTLPMGTIVRLLEKHQNPQSSVVGCLHNLYKSVADMDVDNF
ESQACKHFLLHPRSAKGSHGRDLKLNIDDTEATKFFVCPNFVSTEACRKLFSNVSTMKCRCGSSMHREIPVEEQQADGVF
PSCRTSFVITDDLKVALNSMGLVLNVLNDFGYSGFDKLQEMLIDVGFEEILTLLGCLFTSEAPLTDTFLRKHCMSRKRKM
LTPLVQESSVAGAADNLLTLKVYVRKTDRAVLYAECREEFVDFLFTFLAIPIEFAWELSIDIGNMGCVGNLCRSVKDLSF
EKQKAATVSQCMLPYFYWKGTTS*

DNA
ATGGCTAAGAGCTTTGAGAAGCCGAAGTTTAGCCTAAGACTTCTCATTGATGAGGAGAAAAACAGAGTTATTTTGGCTGA
AGCTGGGAAGGATTTTGTTGATGTGCTCTGTAGTCTTTTGACTCTTCCTATGGGTACCATTGTCAGGTTGCTCGAGAAGC
ATCAGAATCCGCAGTCTTCAGTCGTTGGTTGTTTACACAATCTTTACAAAAGTGTTGCAGACATGGACGTTGATAATTTC
GAGTCTCAAGCTTGTAAGCATTTCTTGCTGCATCCTCGGAGTGCGAAGGGGAGTCATGGCAGAGATCTAAAGCTCAACAT
TGATGACACCGAGGCGACCAAGTTCTTTGTCTGCCCAAATTTTGTTTCTACTGAAGCATGCCGTAAGTTATTCAGCAATG
TTAGTACCATGAAGTGTCGTTGTGGAAGCTCTATGCACCGTGAGATTCCGGTTGAAGAACAGCAAGCTGATGGAGTATTT
CCCAGCTGCAGAACATCATTTGTTATTACGGATGATCTCAAAGTGGCATTGAACTCTATGGGTCTTGTTTTGAATGTCCT
CAATGATTTTGGTTACTCTGGTTTTGATAAGCTGCAAGAAATGCTTATTGATGTTGGTTTTGAAGAGATTCTAACTTTGC
TAGGGTGTTTGTTCACTTCGGAAGCTCCATTGACAGACACCTTCCTGAGGAAACATTGCATGTCAAGGAAACGTAAAATG
TTGACACCACTTGTACAAGAAAGCAGTGTTGCAGGAGCTGCAGACAATCTCTTAACTTTGAAAGTTTATGTTAGAAAGAC
AGACAGGGCTGTTCTCTATGCTGAGTGCAGAGAAGAATTCGTTGATTTTCTTTTCACTTTTCTTGCCATCCCGATTGAGT
TTGCTTGGGAACTTTCTATTGACATTGGTAATATGGGCTGTGTTGGTAATCTGTGCAGAAGTGTGAAAGATTTGAGCTTT
GAGAAGCAGAAAGCAGCCACAGTTTCTCAATGCATGCTTCCTTATTTCTACTGGAAGGGCACAACCTCTTGA