Details for Arabidopsis Locus AT3G09090

Position : Chr3 ( 5`- 2782698 .. 2787804 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09090

Protein [Map View]
MKSRARQCLLVCLLCLSLTNLSYGENKFRERKATDDELGYPDIDEDALLNTQCPKKLELRWQTEVTSSVYATPLIADINS
DGKLDIVVPSFVHYLEVLEGADGDKMPGWPAFHQSNVHSSPLLFDIDKDGVREIALATYNAEVLFFRVSGFLMSDKLEVP
RRKVHKNWHVGLNPDPVDRSHPDVHDDVLEEEAMAMKSSTTQTNATTTTPNVTVSMTKEVHGANSYVSTQEDQKRPENNQ
TEAIVKPTPELHNSSMDAGANNLAANATTAGSRENLNRNVTTNEVDQSKISGDKNETVIKLNTSTGNSSETLGTSGNSST
AETVTKSGRRLLEEDGSKESVDSHSDSKDNSEGVRMATVENDGGLEADADSSFELLRENDELADEYSYDYDDYVDEKMWG
DEEWVEGQHENSEDYVNIDAHILCTPVIADIDKDGVQEMIVAVSYFFDPEYYDNPEHLKELGGIDIKNYIASSIVVFNLD
TKQVKWIKELDLSTDKANFRAYIYSSPTVVDLDGDGYLDILVGTSFGLFYAMDHRGNIREKFPLEMAEIQGAVVAADIND
DGKIELVTTDSHGNIAAWTTQGVEIWEAHLKSLVPQGPSIGDVDGDGHTEVVVPTSSGNIYVLSGKDGSIVRPYPYRTHG
RVMNQLLLVDLNKRGEKKKGLTIVTTSFDGYLYLIDGPTSCTDVVDIGETSYSMVLADNVDGGDDLDLIVSTMNGNVFCF
STPSPHHPLKAWRSSDQGRNNKANRYDREGVFVTHSTRGFRDEEGKNFWAEIEIVDKYRYPSGSQAPYNVTTTLLVPGNY
QGERRITQSQIYDRPGKYRIKLPTVGVRTTGTVMVEMADKNGLHFSDEFSLTFHMYYYKLLKWLLVLPMLGMFGLLVILR
PQEAVPLPSFSRNTDL*

DNA
ATGAAATCTCGAGCGAGGCAGTGTCTGCTGGTTTGTTTGCTCTGTCTTTCCTTAACGAATCTCTCCTATGGAGAAAATAA
GTTCAGAGAGCGTAAAGCCACCGATGACGAGCTGGGCTACCCCGATATTGATGAAGATGCTTTATTGAATACTCAGTGCC
CGAAAAAATTGGAGCTGCGATGGCAAACTGAAGTCACTTCTAGCGTTTATGCTACACCCTTGATTGCTGATATTAACAGT
GATGGAAAGCTTGACATTGTTGTTCCATCTTTTGTTCATTACCTCGAAGTTCTTGAAGGAGCTGATGGAGACAAGATGCC
AGGTTGGCCTGCTTTTCACCAGTCAAATGTGCACTCGAGTCCTCTTCTATTTGATATCGACAAAGATGGTGTTAGAGAAA
TTGCTCTGGCTACCTACAATGCCGAAGTGCTCTTTTTCAGGGTATCAGGCTTTTTGATGTCAGATAAGCTAGAAGTGCCA
CGTAGAAAAGTGCACAAGAACTGGCATGTGGGACTTAATCCTGATCCTGTTGACCGTTCACATCCTGATGTTCATGATGA
TGTGCTTGAGGAGGAAGCTATGGCAATGAAGTCATCGACCACTCAAACGAATGCAACTACCACAACACCAAATGTTACAG
TCTCGATGACCAAAGAAGTTCATGGCGCTAATTCATATGTGTCAACTCAAGAGGATCAAAAGAGACCAGAGAATAATCAA
ACAGAAGCTATTGTAAAGCCTACTCCAGAGCTACATAATTCCTCCATGGATGCTGGAGCAAATAATTTGGCAGCAAATGC
TACTACAGCTGGCTCAAGAGAAAACCTCAATAGAAATGTAACCACCAATGAGGTGGATCAAAGCAAAATTAGTGGAGATA
AGAATGAAACTGTTATTAAATTAAATACTAGTACGGGTAATTCCTCAGAAACTCTGGGGACATCTGGAAACAGTAGTACG
GCAGAGACAGTAACCAAAAGTGGGAGGCGACTTCTGGAAGAGGATGGTTCGAAAGAATCTGTGGACAGCCATTCGGACAG
TAAAGACAACAGTGAGGGTGTCCGCATGGCGACAGTAGAAAATGATGGAGGCTTAGAAGCTGACGCAGATTCATCGTTTG
AGTTGTTGCGTGAGAATGATGAGTTAGCTGATGAATACAGTTATGATTATGACGATTATGTTGATGAGAAAATGTGGGGT
GATGAGGAATGGGTTGAGGGGCAGCACGAGAACTCAGAAGATTATGTGAATATTGACGCCCATATACTATGCACTCCTGT
AATTGCTGACATAGACAAAGATGGAGTACAGGAGATGATTGTTGCTGTTTCCTATTTCTTCGACCCCGAGTACTATGATA
ATCCAGAACATCTGAAAGAGCTTGGTGGTATCGACATTAAAAATTATATTGCTAGTTCAATTGTGGTTTTCAATCTTGAT
ACTAAACAAGTCAAGTGGATCAAAGAGCTAGATTTGAGTACGGATAAAGCAAACTTCCGTGCTTATATTTATTCTTCACC
AACGGTTGTTGATTTGGATGGCGATGGTTATTTGGATATCCTTGTCGGAACTTCCTTTGGCTTATTCTACGCCATGGATC
ATCGTGGAAACATCAGAGAAAAATTCCCACTGGAAATGGCTGAAATTCAAGGAGCAGTGGTTGCGGCCGACATAAATGAT
GATGGAAAGATTGAACTTGTAACTACTGATTCACACGGAAATATAGCAGCATGGACCACCCAAGGAGTGGAAATTTGGGA
AGCACATCTTAAGAGCCTTGTTCCCCAGGGTCCTTCTATAGGCGATGTTGATGGTGACGGACACACGGAGGTTGTGGTTC
CTACATCATCAGGAAACATATACGTTCTTAGTGGCAAGGATGGTTCTATTGTCCGTCCTTACCCATACAGGACTCATGGA
AGAGTGATGAACCAACTTCTTCTTGTTGATCTGAACAAGCGAGGTGAGAAAAAGAAGGGTCTCACCATCGTTACTACATC
CTTTGACGGTTACCTGTATCTCATAGATGGACCCACCTCGTGCACTGACGTTGTTGACATTGGCGAAACTTCATACAGCA
TGGTCTTGGCTGATAATGTTGACGGTGGAGATGATCTCGATCTTATTGTCTCAACTATGAATGGAAACGTCTTTTGCTTC
TCAACGCCTTCTCCTCACCATCCCCTTAAGGCTTGGAGATCTAGTGATCAAGGCAGGAACAATAAGGCCAATCGTTATGA
TCGTGAAGGCGTTTTTGTCACGCATTCGACCAGAGGTTTCCGTGATGAGGAAGGCAAAAACTTCTGGGCTGAGATCGAGA
TCGTTGATAAATATAGATATCCATCTGGTTCACAAGCACCCTACAACGTTACTACGACGCTGTTGGTTCCAGGCAATTAC
CAGGGAGAGAGGAGGATAACGCAGAGCCAGATCTATGACCGCCCTGGAAAATACCGGATAAAACTACCAACTGTGGGAGT
GAGAACAACAGGAACTGTAATGGTGGAGATGGCAGATAAGAATGGACTCCATTTCTCAGACGAATTCTCACTAACTTTCC
ATATGTATTACTACAAGCTTCTGAAATGGCTTCTTGTTCTCCCGATGCTCGGGATGTTCGGTCTGCTCGTGATACTACGG
CCTCAAGAAGCCGTGCCTCTCCCGTCTTTTTCCCGCAACACAGATTTATGA