Details for Arabidopsis Locus AT3G09070

Position : Chr3 ( 5`- 2768688 .. 2771174 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09070

Protein [Map View]
MNPATDPVSAAAAALAPPPQPPQPHRLSTSCNRHPEERFTGFCPSCLCERLSVLDQTNNGGSSSSSKKPPTISAAALKAL
FKPSGNNGVGGVNTNGNGRVKPGFFPELRRTKSFSASKNNEGFSGVFEPQRRSCDVRLRSSLWNLFSQDEQRNLPSNVTG
GEIDVEPRKSSVAEPVLEVNDEGEAESDDEELEEEEEEDYVEAGDFEILNDSGELMREKSDEIVEVREEIEEAVKPTKGL
SEEELKPIKDYIDLDSQTKKPSVRRSFWSAASVFSKKLQKWRQNQKMKKRRNGGDHRPGSARLPVEKPIGRQLRDTQSEI
ADYGYGRRSCDTDPRFSLDAGRFSLDAGRFSVDIGRISLDDPRYSFDEPRASWDGSLIGRTMFPPAARAPPPPSMLSVVE
DAPPPVHRHVTRADMQFPVEEPAPPPPVVNQTNGVSDPVIIPGGSIQTRDYYTDSSSRRRKSLDRSSSSMRKTAAAVVAD
MDEPKLSVSSAISIDAYSGSLRDNNNYAVETADNGSFREPAMMIGDRKVNSNDNNKKSRRWGKWSILGLIYRKSVNKYEE
EEEEEEDRYRRLNGGMVERSLSESWPELRNGGGGGGGPRMVRSNSNVSWRSSGGGSARKVNGLDRRNKSSRYSPKNGENG
MLKFYLPHMKASRRMSGTGGAGGGGGGGWANSHGHSIARSVMRLY*

DNA
ATGAATCCAGCTACTGACCCAGTCTCCGCCGCCGCAGCTGCTCTTGCTCCGCCTCCACAACCTCCGCAGCCTCACCGTCT
CTCTACCTCTTGCAACCGTCACCCAGAAGAGCGGTTCACCGGTTTTTGCCCTTCTTGTCTCTGTGAACGTCTCTCAGTCT
TAGATCAGACCAACAATGGCGGTTCCTCTTCTTCCTCTAAAAAGCCTCCGACCATCTCTGCTGCGGCTCTCAAGGCTCTC
TTTAAGCCTTCCGGAAACAACGGAGTGGGCGGTGTAAATACAAACGGAAACGGCCGGGTTAAACCCGGATTCTTCCCGGA
GCTCCGTCGTACGAAATCTTTCTCAGCATCCAAGAACAACGAAGGATTCTCCGGCGTGTTTGAGCCACAACGTAGGTCTT
GTGACGTCAGGCTTCGAAGCTCTCTTTGGAACTTGTTTAGCCAAGATGAGCAACGAAACCTTCCAAGCAATGTCACCGGC
GGTGAGATTGATGTCGAGCCGAGGAAATCAAGCGTTGCGGAGCCTGTTCTAGAGGTAAACGATGAAGGAGAAGCTGAAAG
TGACGACGAAGAACTTGAAGAGGAGGAGGAGGAAGACTACGTTGAAGCTGGCGACTTTGAGATTCTCAATGATTCCGGCG
AACTAATGAGGGAAAAAAGCGACGAGATTGTTGAAGTTAGAGAGGAGATTGAAGAAGCGGTGAAACCAACAAAGGGTTTA
AGCGAAGAGGAGTTAAAGCCAATAAAGGATTACATAGATCTTGATTCTCAAACCAAGAAGCCATCGGTACGACGGAGTTT
TTGGTCGGCGGCCTCTGTTTTCAGCAAGAAGCTTCAGAAATGGAGGCAGAATCAAAAGATGAAGAAGCGGCGTAACGGCG
GCGACCATCGGCCAGGATCAGCTAGATTACCGGTGGAGAAACCGATTGGGAGACAGCTCCGGGATACTCAATCGGAGATT
GCTGATTACGGATATGGTCGGAGGTCGTGCGATACCGACCCTCGATTCTCTCTAGACGCCGGAAGATTCTCTCTTGACGC
CGGTAGATTCTCCGTTGACATCGGTAGGATCTCGCTTGATGATCCTCGTTATTCGTTTGACGAGCCGAGAGCTTCTTGGG
ACGGGTCTTTGATTGGACGGACAATGTTTCCTCCCGCCGCGAGAGCTCCTCCGCCGCCGTCAATGCTCTCGGTGGTGGAG
GATGCGCCGCCGCCGGTGCACCGTCACGTAACCCGAGCGGATATGCAGTTTCCGGTGGAAGAACCGGCGCCACCACCACC
GGTGGTTAACCAAACCAACGGTGTGTCAGACCCGGTTATCATACCCGGCGGATCAATCCAAACCCGAGACTACTATACTG
ACTCATCGTCAAGGAGGCGGAAAAGTCTCGACAGGTCTAGTAGCTCCATGAGGAAAACGGCTGCAGCCGTTGTGGCGGAT
ATGGACGAGCCAAAGCTTTCAGTGTCGTCGGCTATATCAATTGACGCTTACTCAGGATCACTGAGAGATAACAACAACTA
CGCCGTGGAGACGGCAGATAACGGATCTTTCCGGGAACCGGCGATGATGATCGGCGATAGGAAAGTGAATAGTAACGATA
ATAACAAGAAGTCGAGACGGTGGGGGAAGTGGAGCATTTTAGGACTTATTTACAGGAAGAGTGTTAACAAGTATGAGGAA
GAGGAGGAGGAGGAAGAGGATAGGTATAGGAGATTAAACGGTGGAATGGTGGAGAGATCGTTATCGGAGTCATGGCCGGA
GCTGAGGAATGGAGGAGGAGGAGGAGGAGGGCCGAGGATGGTGAGGAGTAATAGCAATGTGAGCTGGAGGAGTTCCGGAG
GTGGATCAGCGAGGAAAGTCAACGGATTGGATAGGAGGAATAAGAGTTCAAGGTACTCACCTAAGAATGGGGAAAACGGA
ATGTTGAAGTTTTACTTGCCACATATGAAAGCTAGTCGGAGAATGAGCGGTACAGGAGGAGCAGGAGGTGGCGGCGGCGG
AGGGTGGGCGAATAGTCACGGGCATTCTATAGCGAGGAGTGTAATGAGGCTGTATTGA