Details for Arabidopsis Locus AT3G09050

Position : Chr3 ( 5`- 2764651 .. 2766144 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09050

Protein [Map View]
MMNTLHAFQTTLTPNFHVLFNASRHSLSRPQFLCLSKSGDGTSDSDSDPDPPKPEGDTRRQELLARIAMIQTSKVRLTDF
LDERSEYLTKFAEEANAEFDKVGEDAMKDLDEASTRILENIESKMQAFEESAGLNRLEIEENDNKLAEFEEKIQVDRNEG
LFFKSLRDKKPVDREQAREETEKIQEVTKESAGSKSRRNIYLGLIGIVVLAIADSFVSSPDWRKVAILGAILVPLLTQFV
YEQTLLSEADKGKENKKE*

DNA
ATGATGAACACACTTCATGCATTTCAGACAACCTTAACACCAAACTTTCATGTTCTTTTCAATGCCTCGAGACATTCTCT
TTCCCGACCCCAATTTCTCTGTCTCTCCAAATCGGGAGACGGAACTTCAGATTCTGATTCTGATCCCGACCCTCCAAAAC
CCGAAGGCGATACTCGCAGGCAAGAACTCTTAGCTAGGATCGCCATGATTCAGACATCGAAGGTCCGTTTGACGGATTTC
TTGGACGAGAGATCAGAGTATCTCACCAAGTTTGCTGAAGAAGCCAATGCGGAGTTTGACAAGGTTGGAGAAGACGCCAT
GAAAGACCTTGACGAAGCTAGCACAAGGATACTGGAGAATATCGAAAGCAAGATGCAAGCTTTTGAGGAATCTGCGGGAT
TGAACAGATTAGAGATCGAGGAGAACGATAATAAGTTGGCTGAGTTTGAGGAGAAGATTCAAGTAGACAGGAATGAAGGA
TTGTTCTTTAAAAGCTTACGTGACAAAAAACCAGTGGATAGAGAGCAAGCTAGAGAGGAAACTGAGAAAATACAAGAGGT
TACCAAAGAAAGTGCAGGATCAAAGTCAAGAAGGAATATTTACCTCGGGTTAATTGGGATTGTGGTTCTCGCAATTGCTG
ATTCCTTCGTTTCTTCACCGGATTGGAGAAAAGTCGCAATTCTTGGAGCTATCCTTGTCCCACTGCTCACTCAATTCGTA
TACGAGCAGACATTATTATCAGAAGCAGATAAGGGAAAGGAAAACAAGAAGGAATGA