Details for Arabidopsis Locus AT3G09040

Position : Chr3 ( 5`- 2761195 .. 2764281 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09040

Protein [Map View]
MYFRVLLTPSSAMFDSFSFVRRLSYSPDLGRRIYGHVLPSHDQIHQRLLEICLGQCKLFKSRKVFDEMPQRLALALRIGK
AVHSKSLILGIDSEGRLGNAIVDLYAKCAQVSYAEKQFDFLEKDVTAWNSMLSMYSSIGKPGKVLRSFVSLFENQIFPNK
FTFSIVLSTCARETNVEFGRQIHCSMIKMGLERNSYCGGALVDMYAKCDRISDARRVFEWIVDPNTVCWTCLFSGYVKAG
LPEEAVLVFERMRDEGHRPDHLAFVTVINTYIRLGKLKDARLLFGEMSSPDVVAWNVMISGHGKRGCETVAIEYFFNMRK
SSVKSTRSTLGSVLSAIGIVANLDLGLVVHAEAIKLGLASNIYVGSSLVSMYSKCEKMEAAAKVFEALEEKNDVFWNAMI
RGYAHNGESHKVMELFMDMKSSGYNIDDFTFTSLLSTCAASHDLEMGSQFHSIIIKKKLAKNLFVGNALVDMYAKCGALE
DARQIFERMCDRDNVTWNTIIGSYVQDENESEAFDLFKRMNLCGIVSDGACLASTLKACTHVHGLYQGKQVHCLSVKCGL
DRDLHTGSSLIDMYSKCGIIKDARKVFSSLPEWSVVSMNALIAGYSQNNLEEAVVLFQEMLTRGVNPSEITFATIVEACH
KPESLTLGTQFHGQITKRGFSSEGEYLGISLLGMYMNSRGMTEACALFSELSSPKSIVLWTGMMSGHSQNGFYEEALKFY
KEMRHDGVLPDQATFVTVLRVCSVLSSLREGRAIHSLIFHLAHDLDELTSNTLIDMYAKCGDMKGSSQVFDEMRRRSNVV
SWNSLINGYAKNGYAEDALKIFDSMRQSHIMPDEITFLGVLTACSHAGKVSDGRKIFEMMIGQYGIEARVDHVACMVDLL
GRWGYLQEADDFIEAQNLKPDARLWSSLLGACRIHGDDIRGEISAEKLIELEPQNSSAYVLLSNIYASQGCWEKANALRK
VMRDRGVKKVPGYSWIDVEQRTHIFAAGDKSHSEIGKIEMFLEDLYDLMKDDAVVNPDIVEQGSLDCV*

DNA
ATGTATTTCCGAGTTCTCTTGACGCCGTCCTCGGCCATGTTTGATTCTTTCTCCTTTGTACGTCGTTTGAGTTATTCCCC
GGATTTGGGTCGTCGAATCTATGGACATGTTTTGCCCAGCCATGATCAGATACATCAACGTCTCCTAGAAATCTGTTTGG
GGCAATGCAAATTATTCAAGAGTCGCAAAGTGTTCGACGAAATGCCTCAAAGACTTGCACTAGCCTTGAGAATTGGCAAA
GCTGTCCATTCCAAAAGCTTGATACTTGGAATAGATTCAGAAGGTAGATTAGGTAACGCCATTGTGGATTTATATGCCAA
GTGTGCACAAGTTTCTTATGCTGAGAAGCAATTCGACTTCCTTGAAAAAGATGTAACGGCGTGGAACTCAATGCTATCGA
TGTATTCCAGCATTGGGAAACCAGGAAAGGTCTTAAGGAGTTTTGTATCATTGTTTGAGAATCAGATTTTTCCAAATAAA
TTCACTTTTTCGATTGTTTTATCAACCTGTGCCAGGGAGACTAATGTAGAGTTTGGTAGACAAATTCATTGCAGTATGAT
TAAAATGGGGCTAGAACGCAACTCGTATTGTGGAGGGGCTTTAGTTGATATGTATGCCAAGTGTGACCGTATTAGTGATG
CTCGACGAGTTTTTGAATGGATAGTGGATCCTAATACAGTTTGCTGGACGTGTTTGTTTTCTGGCTATGTGAAGGCTGGT
TTGCCAGAGGAAGCTGTCTTAGTATTTGAAAGGATGCGGGATGAAGGCCATCGGCCTGATCATTTAGCTTTTGTGACTGT
TATAAATACGTACATCAGGTTGGGGAAGCTAAAGGATGCACGTCTGTTGTTTGGGGAGATGTCAAGCCCAGATGTGGTAG
CGTGGAATGTAATGATTTCAGGGCATGGGAAAAGAGGATGTGAGACTGTGGCTATTGAATATTTTTTCAATATGCGGAAA
TCTAGTGTTAAATCCACCCGTTCTACCTTAGGAAGCGTTTTGAGTGCTATTGGGATTGTAGCTAATCTTGATTTAGGTTT
GGTAGTTCATGCAGAGGCTATTAAACTAGGTCTCGCTTCCAATATTTATGTCGGCAGTTCTTTGGTTAGCATGTACTCGA
AATGTGAGAAAATGGAGGCTGCTGCAAAGGTATTTGAAGCTTTGGAGGAAAAAAATGACGTCTTCTGGAACGCGATGATA
AGGGGTTATGCACATAATGGTGAATCCCACAAGGTTATGGAACTGTTTATGGATATGAAATCTTCTGGTTATAACATTGA
TGACTTTACCTTTACAAGCCTTTTAAGCACTTGTGCTGCATCACATGATCTAGAAATGGGAAGCCAGTTTCACTCAATCA
TCATCAAGAAGAAGTTAGCAAAAAACTTATTCGTAGGAAATGCATTAGTAGATATGTATGCAAAATGCGGAGCTCTTGAA
GATGCAAGGCAAATTTTTGAGCGCATGTGTGATCGTGATAATGTAACTTGGAACACAATAATTGGGAGTTATGTCCAAGA
TGAGAATGAGAGTGAAGCTTTTGACTTGTTCAAGAGGATGAATTTGTGTGGTATAGTGTCTGATGGAGCATGTTTGGCTA
GCACACTTAAGGCATGTACACATGTTCATGGTCTTTATCAAGGAAAACAAGTTCACTGCCTCTCTGTCAAATGTGGCCTA
GACAGAGATCTTCATACTGGTAGCTCGCTCATTGACATGTATTCCAAGTGTGGAATCATCAAAGATGCACGTAAAGTTTT
CTCTTCTCTGCCTGAGTGGAGCGTTGTGTCAATGAATGCTCTAATTGCAGGTTATTCTCAGAACAACTTAGAAGAAGCTG
TAGTTCTCTTTCAAGAAATGCTGACCAGAGGTGTTAACCCATCTGAAATCACTTTTGCCACCATTGTTGAAGCTTGTCAT
AAACCAGAAAGTTTAACTCTAGGAACGCAATTTCATGGTCAGATAACAAAGAGGGGCTTCTCATCTGAAGGTGAATATCT
AGGGATTTCCCTTTTGGGCATGTACATGAATTCACGTGGAATGACAGAGGCTTGTGCACTCTTCTCAGAGTTATCAAGCC
CTAAGAGTATTGTTCTTTGGACGGGAATGATGTCAGGTCACAGTCAGAATGGATTTTATGAGGAGGCCTTGAAGTTTTAC
AAAGAAATGCGTCATGATGGTGTTCTACCTGACCAGGCAACATTTGTCACTGTTCTTCGAGTGTGTTCTGTCCTTTCCTC
TTTAAGAGAAGGTAGAGCTATCCATTCTCTTATTTTTCACTTGGCCCATGACTTGGACGAGTTGACCTCTAACACCCTAA
TAGACATGTATGCTAAATGTGGGGACATGAAAGGTTCGTCACAAGTTTTCGATGAAATGAGGCGTAGAAGCAACGTTGTC
TCATGGAACTCCTTGATCAATGGATATGCGAAAAATGGTTACGCTGAAGATGCCCTGAAAATCTTTGATTCTATGAGACA
ATCCCATATCATGCCAGATGAAATCACTTTCCTAGGTGTTCTTACAGCTTGTAGCCATGCAGGGAAAGTGTCAGATGGAC
GAAAGATTTTTGAGATGATGATTGGTCAATATGGTATTGAAGCGCGTGTAGATCATGTAGCTTGTATGGTTGATCTTCTT
GGGAGATGGGGATATCTTCAAGAAGCTGATGACTTCATAGAAGCACAAAACCTGAAACCAGATGCAAGACTTTGGTCATC
TCTTCTTGGTGCATGTAGGATTCATGGAGATGACATTAGGGGAGAAATTTCTGCCGAGAAGCTCATTGAATTAGAACCAC
AAAACTCGTCAGCTTATGTTCTTCTTTCGAACATATATGCCTCACAGGGATGTTGGGAAAAGGCCAATGCTTTGAGGAAA
GTCATGAGAGACAGAGGAGTCAAGAAGGTACCTGGATATAGCTGGATTGATGTGGAACAGAGAACACACATTTTTGCTGC
AGGAGACAAATCTCATTCTGAAATAGGAAAAATCGAGATGTTCCTCGAGGATCTTTATGATTTGATGAAAGATGATGCCG
TTGTCAATCCTGATATCGTGGAACAAGGTTCTCTTGATTGTGTGTAA