Details for Arabidopsis Locus AT3G09035

Position : Chr3 ( 5`- 2758820 .. 2760347 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09035

Protein [Map View]
MAMFKTLSFLFLLCFQIHGTVAADENSLFSFNGFVKSPSFDKRVALFGDSKLVNDSSLIQLTDSVTRSVGRVVYKKPINL
FKGKQRNSRSFSTHFSFSSMSNEIGDDVLAFVMVPSSLDLSLFGKKDNSSSALGFLSQYAKNETVVAVEFGISRTGNSAR
ILVGRPESAEIRNLSFVGDLMMDNGRTLSCMIEYEASSKRMMVRFRKSGSVKLFDPFFSFSVDLAKLWKGGEVTVGLSSA
NGNSSSKAHFLHSWRFEIRHPPPMWMHSVPLEPNEVSKEEENGRGRSECTRKMLGALIFGAACGALGALLGLYLWTICRV
RRSMAVVPEECAIEQGKK*

DNA
ATGGCCATGTTCAAAACCTTATCTTTTTTGTTCCTTTTGTGCTTTCAGATACATGGAACGGTGGCTGCAGATGAAAATTC
CTTGTTTTCATTCAATGGTTTTGTAAAATCTCCGAGCTTTGACAAGAGGGTTGCTCTGTTTGGAGATTCGAAGCTGGTCA
ATGACAGTTCTTTGATTCAGCTGACTGACTCAGTGACTCGAAGCGTTGGTCGAGTCGTTTACAAGAAACCCATCAATCTT
TTCAAAGGTAAACAGAGGAATTCGAGATCTTTCTCTACTCACTTCTCGTTTTCTTCCATGTCCAACGAGATTGGTGATGA
TGTCTTGGCTTTTGTAATGGTTCCATCTAGTTTGGATCTTAGTCTGTTTGGTAAGAAGGACAACAGTTCCTCTGCTTTAG
GTTTTTTATCACAATATGCAAAGAACGAGACAGTTGTTGCTGTCGAGTTTGGTATCTCCAGGACAGGAAACAGTGCAAGA
ATTTTAGTTGGTAGACCTGAATCTGCTGAAATTAGAAACCTTTCGTTTGTGGGTGACTTGATGATGGACAATGGAAGGAC
TCTGAGCTGTATGATTGAGTATGAGGCAAGTTCTAAGAGAATGATGGTTCGATTCAGAAAATCTGGTTCGGTAAAGCTGT
TTGATCCGTTCTTCTCTTTCTCGGTAGACTTGGCCAAGTTATGGAAAGGTGGTGAAGTCACTGTGGGTTTAAGCTCTGCC
AATGGGAACTCTTCTTCCAAGGCACATTTTCTCCATTCATGGAGATTTGAAATAAGACATCCTCCTCCGATGTGGATGCA
TTCAGTGCCGCTTGAACCGAATGAAGTTTCAAAGGAGGAGGAAAATGGTCGAGGGAGAAGTGAGTGTACGCGGAAAATGC
TTGGTGCTTTGATCTTTGGTGCAGCTTGTGGAGCCTTAGGGGCACTGCTGGGTTTGTATCTCTGGACGATATGCCGTGTT
AGGCGGTCAATGGCCGTGGTTCCAGAGGAATGTGCTATTGAACAAGGCAAGAAGTAG