Details for Arabidopsis Locus AT3G09020

Position : Chr3 ( 5`- 2753307 .. 2754621 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09020

Protein [Map View]
MDHDITTKVRAMFDHRRLNRSGSSLFTAFASTVIALVVFTIVLVSNLSVREDFSAKVVTIEIKTIVPYLPLSSEKEVSDQ
VNNNYSIKQQITVKEEINKLQVLEVFGGKDVSEKFQQRATEFLRDDCEVKFMMTWISPAELFGKREILSVESVFKSHARG
CLMILSSTMDSLQGFRILKPFLDRGYRVMAVTPDLPFLLKDTAGESWLEEIQTGKRDPGKISLAQNLSNLMRLAYLFKFG
GVYLDTDMIVLKSFKTLRNVIGAQTLEPVSRNWTRLNNAVLIFDKNHPFLLKSIEEFALTFNGNVWGHNGPYLVSRVARA
VEGTDGYNFTILTPPAFYPVNWVEIEKLFKVPRTEKDSKRVQVKVLEMQKRSYGLHLWNKFSRKFEIEQGSAMDKLVSNQ
CIICDSVVSVS*

DNA
ATGGATCATGACATCACGACGAAAGTCAGGGCGATGTTTGATCACCGTAGGTTAAACCGCTCTGGATCATCACTCTTCAC
AGCGTTTGCTTCCACGGTTATAGCTCTGGTCGTTTTCACCATCGTTCTCGTCTCTAATTTATCGGTGAGAGAAGATTTCT
CAGCGAAGGTGGTGACAATAGAGATCAAGACAATTGTTCCTTACTTACCTCTAAGCTCAGAGAAGGAGGTAAGTGATCAA
GTCAACAATAACTATTCGATCAAGCAACAAATCACAGTCAAAGAAGAGATTAACAAACTGCAAGTTCTTGAAGTTTTTGG
AGGCAAAGACGTGTCGGAGAAGTTTCAACAGAGAGCAACAGAGTTTTTGAGAGATGATTGTGAGGTCAAGTTCATGATGA
CATGGATCTCACCTGCGGAATTGTTCGGTAAGAGAGAGATATTATCTGTAGAAAGCGTATTCAAATCTCATGCTAGAGGT
TGTTTGATGATTTTATCATCCACAATGGATTCTCTTCAAGGGTTTAGAATCCTGAAACCGTTTCTTGATCGAGGTTACAG
AGTTATGGCGGTCACGCCGGATTTGCCTTTTCTTCTCAAGGACACAGCCGGAGAATCTTGGCTTGAAGAGATTCAGACCG
GTAAAAGAGATCCAGGAAAGATCTCTCTAGCTCAGAATCTATCAAACCTCATGAGACTTGCTTATTTGTTCAAATTCGGA
GGTGTTTATCTAGACACAGACATGATTGTTTTAAAGAGCTTTAAAACTCTAAGGAACGTGATCGGTGCGCAGACTCTGGA
GCCGGTTTCGAGAAACTGGACAAGATTGAACAATGCGGTATTGATCTTCGACAAGAATCATCCATTCTTGCTCAAATCCA
TTGAAGAATTTGCGTTGACTTTTAATGGAAACGTTTGGGGACATAACGGACCGTATCTTGTTTCACGAGTGGCTCGAGCC
GTGGAAGGAACCGATGGCTATAACTTCACCATCTTGACACCTCCTGCGTTTTATCCAGTGAATTGGGTTGAGATTGAGAA
GCTATTCAAGGTTCCAAGAACAGAGAAAGATTCAAAGAGAGTTCAAGTCAAGGTTCTTGAAATGCAGAAGAGAAGCTATG
GATTGCATTTGTGGAATAAGTTTAGCAGAAAATTCGAAATTGAACAAGGAAGTGCCATGGATAAATTGGTTTCAAATCAA
TGTATAATTTGTGACAGTGTTGTATCTGTATCATGA