Details for Arabidopsis Locus AT3G08970

Position : Chr3 ( 5`- 2737537 .. 2740530 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G08970

Protein [Map View]
MVRTRLAISVVLVSTLLLLNVKAKSVDPYKVLGVSKDAKQREIQKAFHKQSLKYHPDKNKDKGAQEKFAEINNAYEILSD
EEKRKNYDLYGDEKGQPGFDSGFPGGNGGYSYSSSGGGFNFGGPGGWQNMGGGGGSKSFSFSFGGPSESSFGFGMDDIFS
MFSGGSSKGKEQFGGFGSSSNAESKSKSSTVAAIKTINSQVYKKDVVDQGMTWLLLSYLPSQRGSQYHESIIEEVAESLQ
GALKVGRLNCETESSLCKQLGIVPRRAPRMFVYSYTSSGKATLAEYTEELVAKKVKSFCQEHLPRFSKKIDLNTFDVSAV
SSQKTPKVLLLSTKKDTPVIWRVLSGLYNGRFVFYNTEVHDTSDPKIQKLGVDKFPAIVGWLSNGEKQVLKTGITVKNLK
SAVQELGKLLEGLEKKNKKVSSKSQAGQAPNESSEKIPLLSRPNFDSICGENTPVCIIGAFRSSNGKEKLQSIMSKVSQK
SLSRRQASTTGSQDTVSYSLLDATKQSAFLSSLDKSEFKTSSDKLLIAYKPRRGKFATFKGDMTIEEVEKFVAAVLNGDI
QFTKTRQKPQIK*

DNA
ATGGTGAGAACAAGATTGGCGATATCTGTTGTTCTTGTGTCGACATTGTTGTTGTTGAATGTGAAAGCGAAGAGCGTTGA
TCCTTACAAGGTTCTTGGAGTATCTAAGGATGCAAAGCAGCGTGAAATCCAGAAAGCTTTCCACAAGCAATCTCTGAAAT
ATCATCCAGATAAAAACAAAGATAAGGGTGCTCAGGAGAAGTTTGCTGAGATTAATAATGCGTATGAGATCTTATCTGAT
GAAGAGAAGAGGAAAAACTATGATCTTTATGGAGATGAGAAAGGACAGCCTGGATTTGATTCGGGGTTTCCCGGAGGTAA
TGGTGGGTATTCTTACTCCTCAAGTGGTGGTGGTTTCAACTTTGGAGGGCCTGGTGGTTGGCAAAATATGGGCGGTGGGG
GAGGTTCCAAATCGTTTTCTTTCTCGTTTGGCGGTCCTAGTGAAAGCTCCTTTGGTTTTGGTATGGATGATATCTTTTCC
ATGTTTTCGGGCGGTAGTTCTAAAGGAAAGGAGCAGTTTGGTGGCTTTGGTAGCTCATCGAATGCTGAATCTAAATCAAA
GAGCAGTACTGTAGCAGCTATCAAAACCATTAACTCTCAGGTCTATAAGAAGGACGTTGTGGACCAAGGGATGACTTGGC
TTTTGTTGTCGTATCTTCCATCTCAGAGGGGAAGCCAGTACCATGAATCCATCATAGAGGAAGTTGCTGAGTCGTTGCAA
GGAGCTTTAAAGGTTGGGCGATTAAATTGTGAAACAGAATCCTCTCTTTGCAAACAACTAGGCATAGTTCCTCGTAGGGC
TCCAAGGATGTTTGTTTATTCATACACATCAAGTGGCAAAGCTACCTTAGCAGAATATACTGAAGAGCTTGTTGCAAAGA
AGGTGAAAAGCTTCTGCCAGGAACATCTACCGAGATTCTCAAAAAAGATTGATCTGAATACATTCGATGTATCTGCCGTT
AGCTCACAAAAGACTCCTAAAGTTTTGCTTCTGTCAACAAAGAAAGACACTCCTGTCATCTGGCGGGTTCTAAGTGGCTT
GTACAATGGACGATTTGTCTTTTACAACACAGAGGTCCATGATACTTCTGATCCAAAGATACAAAAGTTGGGGGTAGACA
AGTTTCCGGCAATAGTTGGTTGGTTATCGAATGGGGAGAAGCAAGTCTTGAAAACAGGTATCACTGTGAAAAATCTGAAA
TCAGCTGTCCAGGAACTTGGTAAATTGCTTGAAGGATTAGAGAAGAAGAACAAGAAGGTCTCTTCTAAGAGTCAGGCGGG
CCAAGCCCCTAACGAGTCCTCAGAAAAGATACCTCTTCTGTCAAGACCAAATTTTGACTCCATTTGTGGGGAGAACACTC
CTGTTTGTATCATTGGTGCCTTCAGATCGTCAAATGGTAAAGAGAAGCTGCAGTCAATAATGTCCAAGGTATCCCAGAAA
TCACTCTCTCGACGACAAGCTTCAACCACAGGTTCTCAGGACACAGTATCCTATTCGCTTCTAGACGCAACAAAACAATC
TGCGTTCTTGAGCTCCCTTGACAAATCAGAGTTCAAAACTTCTTCTGATAAGCTCCTAATAGCTTACAAGCCTCGACGAG
GTAAGTTTGCTACATTCAAAGGCGATATGACTATTGAGGAAGTTGAGAAATTCGTAGCAGCTGTTCTTAACGGAGACATA
CAGTTCACAAAGACAAGACAGAAACCCCAGATCAAATGA