Details for Arabidopsis Locus AT3G08950

Position : Chr3 ( 5`- 2727215 .. 2729601 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G08950

Protein [Map View]
MASALCRTASRLRSVQLFRRIRVSSDLLSASSPSPACISDALRHGDFSLPRSFFSLNCGIEMLKMDQRCLLSTSASDTTS
KHDSGKPETKSSEKNEKSGGSESSDGGSDHKNERASGKDVRGGPVSWMSFFLLFATGAGLVYYYDTQKKRHIEDINKNSI
AVKEGPSAGKAAIGGPFSLIRDDGKRVTEKNLMGKWTILYFGFTHCPDICPDELIKLAAAIDKIKENSGVDVVPVFISVD
PERDTVQQVHEYVKEFHPKLIGLTGSPEEIKSVARSYRVYYMKTEEEDSDYLVDHSIVMYLMSPEMNFVKFYGKNHDVDS
LTDGVVKEIRQYRK*

DNA
ATGGCGTCTGCTCTATGTAGAACTGCAAGCCGTCTTCGTTCCGTTCAACTTTTTCGTCGGATTCGCGTCTCCAGCGATCT
ACTATCGGCATCGTCTCCTTCTCCGGCGTGCATCTCCGACGCGCTTCGTCATGGAGATTTCTCTCTTCCTCGATCGTTTT
TTTCACTTAACTGTGGAATCGAAATGCTGAAAATGGATCAGAGATGTTTGCTGAGTACTTCTGCTTCTGATACTACCTCG
AAACATGACTCAGGTAAACCGGAAACAAAATCTTCGGAGAAAAATGAGAAATCTGGAGGATCGGAGAGTTCTGATGGTGG
TTCAGATCATAAAAACGAGCGTGCTTCTGGAAAAGACGTTCGTGGAGGGCCGGTTTCATGGATGAGCTTTTTCTTGCTGT
TTGCTACTGGAGCTGGATTGGTCTACTATTATGACACACAAAAGAAACGTCATATCGAAGATATAAATAAGAACTCTATA
GCCGTCAAGGAGGGGCCATCTGCTGGAAAAGCAGCCATTGGAGGACCATTCAGCCTTATAAGAGACGATGGGAAACGTGT
GACGGAGAAAAACTTGATGGGAAAATGGACCATTTTATACTTTGGTTTCACTCATTGTCCCGATATCTGTCCTGACGAAC
TTATTAAGTTAGCTGCTGCCATTGACAAAATAAAGGAAAATTCGGGAGTAGACGTGGTGCCAGTGTTTATCTCTGTGGAC
CCTGAAAGAGACACAGTTCAGCAAGTACATGAATATGTCAAAGAATTTCACCCGAAATTGATCGGGTTAACTGGGAGCCC
TGAAGAAATCAAATCGGTGGCCCGATCTTACCGGGTTTACTACATGAAGACCGAAGAGGAAGATTCAGACTATCTCGTTG
ATCACTCTATAGTCATGTACTTGATGAGTCCGGAGATGAATTTTGTGAAATTCTACGGGAAGAATCACGATGTTGACTCG
TTGACAGACGGCGTTGTAAAAGAGATCCGTCAGTACCGGAAGTAA