Details for Arabidopsis Locus AT3G08900

Position : Chr3 ( 5`- 2708086 .. 2709714 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G08900

Protein [Map View]
MAQLYSSVKPTPMLKDELDIVIPTIRNLDFLEMWRPFFEQYHLIIVQDGDPSKVINIPVGFDYELYNRNDINRILGPKAS
CISFKDSACRCFGYMVSKKKYIYTIDDDCFVAKDPTGKEINALEQHIKNLLSPSTPHFFNTLYDPYRDGADFVRGYPFSM
REGAITAVSHGLWLNIPDYDAPTQLVKPLEKNSRYVDAVMTIPKGTLFPMCGMNLAFDRELIGPAMYFGLMGDGQPIGRY
DDMWAGWCVKVICDHMGWGVKTGLPYIWHSKASNPFVNLKKEYNGIFWQEEAIPFFQSVTLPKECTSVQQCYLELAKLVR
EKLGKVDPYFITLATGMVTWIEAWEELNSAEGTEAEAPKGKN*

DNA
ATGGCGCAATTGTATTCTTCCGTGAAACCCACGCCAATGTTGAAAGATGAGCTAGACATTGTGATACCTACGATTCGAAA
CCTCGACTTCCTTGAGATGTGGCGACCTTTCTTTGAGCAGTATCATTTGATCATTGTTCAAGATGGTGATCCTTCGAAAG
TCATCAACATTCCAGTAGGGTTTGACTACGAGCTCTACAACAGGAACGACATCAATCGAATCTTGGGTCCCAAGGCCTCT
TGCATTTCCTTCAAGGACTCTGCTTGTCGTTGCTTCGGTTACATGGTCTCCAAAAAGAAGTACATCTACACCATTGATGA
TGATTGCTTTGTTGCAAAGGATCCAACAGGGAAAGAGATCAATGCGCTTGAGCAGCATATCAAGAACCTCTTATCTCCAT
CAACTCCGCATTTCTTTAACACACTTTATGATCCATACAGAGATGGGGCAGACTTTGTTCGTGGATACCCTTTCAGTATG
CGCGAAGGTGCCATAACCGCGGTCTCTCATGGCCTCTGGCTCAACATTCCTGACTATGATGCTCCCACTCAGCTTGTGAA
ACCTCTTGAGAAAAATTCCAGGTATGTTGATGCAGTCATGACCATTCCCAAAGGAACTCTTTTTCCTATGTGTGGTATGA
ACCTTGCTTTTGACCGTGAGCTGATTGGTCCGGCTATGTACTTTGGGCTTATGGGTGATGGACAGCCAATTGGACGCTAT
GACGACATGTGGGCTGGTTGGTGTGTCAAGGTGATATGTGACCACATGGGATGGGGAGTGAAGACGGGTTTGCCTTACAT
ATGGCACAGCAAAGCCAGCAACCCATTCGTGAACCTGAAAAAGGAATACAACGGAATATTTTGGCAGGAAGAGGCGATTC
CGTTCTTTCAATCCGTGACTCTTCCTAAAGAGTGCACTTCGGTGCAGCAATGCTACCTCGAGCTGGCCAAGCTCGTGAGA
GAGAAACTTGGGAAGGTTGATCCTTACTTCATCACACTTGCAACTGGAATGGTCACCTGGATCGAAGCTTGGGAGGAGCT
TAACTCCGCGGAGGGAACTGAGGCTGAGGCACCAAAAGGCAAAAATTAG