Details for Arabidopsis Locus AT3G08890

Position : Chr3 ( 5`- 2706632 .. 2708747 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G08890

Protein [Map View]
MDQILNKVGSYWLGKKANKQLDSVGDDINSLSSSIEGGTKWLVNKIKGKMQKPLPELLKEFGLPVGIFPRDATNYEFNEQ
TRKLTVFIPSICEVGYKDTSVLRFTTTVTGFLEKGKLADVEGMKTKVMIWVKVTSISADSSKVHFTAGMKKSRSRDAYEV
LRDGVEIDKF*

DNA
ATGGATCAGATCTTGAACAAGGTAGGCTCGTACTGGTTAGGTAAGAAGGCGAACAAGCAGCTCGATTCCGTCGGTGACGA
TATCAACTCTTTGTCTTCGAGCATCGAAGGAGGAACAAAATGGTTGGTGAACAAAATCAAAGGAAAAATGCAGAAGCCAT
TGCCCGAGTTACTAAAGGAGTTTGGTTTGCCTGTGGGGATCTTTCCACGTGATGCAACCAACTACGAGTTCAATGAACAG
ACGAGGAAGTTAACTGTCTTTATTCCATCAATCTGCGAAGTTGGTTACAAAGATACATCAGTCTTGAGATTCACCACTAC
AGTTACCGGATTTCTCGAGAAGGGAAAGCTAGCTGATGTTGAAGGGATGAAGACAAAAGTAATGATATGGGTTAAAGTCA
CAAGTATCTCTGCTGATTCTTCAAAGGTACATTTCACGGCAGGGATGAAGAAAAGCAGAAGCCGAGATGCTTATGAGGTT
TTAAGAGATGGCGTTGAGATTGATAAATTCTAG