Details for Arabidopsis Locus AT3G08860

Position : Chr3 ( 5`- 2696559 .. 2699158 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G08860

Protein [Map View]
MRKLTAVNSLLKRNNYLLPRHGSSQTAAQRTSSVRETETETKLPKMPPFNYSPPPYDGPSTAEIIAKRREFLSPALFHFY
NTPLNIVEAKMQYVFDENGRRYLDAFGGIATVSCGHCHPEVVNSVVKQLKLINHSTILYLNHTISDFAEALVSTLPGDLK
VVFFTNSGTEANELAMMMARLYTGCNDIVSLRNSYHGNAAATMGATAQSNWKFNVVQSGVHHAINPDPYRGIFGSDGEKY
ASDVHDLIQFGTSGQVAGFIGESIQGVGGIVELAPGYLPAAYDIVRKAGGVCIADEVQSGFARTGTHFWGFQSHGVIPDI
VTMAKGIGNGIPLGAVVTTPEIAGVLSRRSYFNTFGGNPMCTAAGHAVLRVLHEEKLQENANLVGSHLKRRLTLLKNKYE
LIGDVRGRGLMLGVEFVKDRDLKTPAKAETLHLMDQMKEMGVLVGKGGFYGNVFRITPPLCFTLSDADFLVDVMDHAMSK
M*

DNA
ATGCGGAAGTTAACGGCGGTTAATTCACTACTGAAACGGAACAATTATCTTCTTCCGCGCCATGGCTCCTCACAAACAGC
AGCTCAGAGAACATCCTCCGTCCGCGAGACCGAGACCGAAACAAAACTTCCGAAAATGCCCCCGTTCAATTATTCTCCGC
CGCCTTACGACGGTCCATCTACGGCAGAGATCATCGCAAAGCGGCGAGAGTTCCTCAGCCCCGCTCTTTTTCACTTCTAC
AACACACCCTTAAACATTGTGGAGGCAAAGATGCAGTATGTGTTCGACGAGAATGGACGTCGATATTTAGATGCCTTTGG
AGGAATAGCGACGGTTTCGTGCGGCCATTGCCACCCGGAAGTAGTTAACTCCGTCGTCAAACAGTTGAAACTTATTAACC
ACTCCACCATCCTTTACCTTAACCACACCATCTCCGATTTCGCTGAAGCCCTTGTCTCCACTCTTCCGGGAGATCTCAAG
GTGGTGTTTTTCACGAATTCGGGTACGGAGGCGAATGAACTTGCGATGATGATGGCTAGACTGTATACAGGATGTAACGA
CATCGTTTCGCTTAGGAACTCTTATCATGGAAACGCAGCTGCTACTATGGGTGCCACTGCTCAGTCCAACTGGAAATTCA
ACGTCGTTCAGAGTGGAGTTCATCACGCCATAAATCCAGATCCTTACAGAGGAATATTTGGATCCGACGGTGAAAAGTAC
GCGAGTGATGTACACGATCTTATCCAATTCGGAACGTCCGGTCAAGTCGCCGGTTTCATTGGCGAATCAATCCAGGGTGT
TGGAGGAATCGTAGAGCTTGCTCCCGGATACTTACCGGCGGCTTACGACATCGTGAGGAAAGCCGGAGGAGTTTGCATCG
CCGATGAAGTCCAATCCGGTTTTGCTCGTACCGGAACCCATTTCTGGGGGTTTCAATCCCATGGTGTTATCCCTGACATC
GTCACCATGGCCAAGGGGATCGGTAACGGTATACCACTTGGAGCGGTTGTGACGACACCGGAGATTGCCGGCGTTTTAAG
CCGTCGGAGTTACTTTAATACTTTCGGCGGAAATCCAATGTGCACGGCCGCAGGACACGCAGTACTTAGAGTCCTTCACG
AAGAGAAGCTCCAAGAGAATGCTAACCTCGTTGGCTCACATCTTAAACGTAGACTTACGCTACTCAAAAACAAATACGAA
CTCATTGGAGACGTGAGAGGGAGAGGATTGATGCTAGGAGTTGAGTTTGTCAAAGACCGCGACTTAAAAACTCCTGCAAA
AGCAGAGACCCTTCATTTAATGGATCAAATGAAAGAAATGGGAGTGTTGGTGGGGAAAGGTGGATTCTATGGGAATGTCT
TCAGAATCACTCCTCCTCTCTGCTTCACCCTCTCCGACGCTGATTTCCTCGTGGATGTGATGGATCACGCCATGTCCAAG
ATGTGA