Details for Arabidopsis Locus AT3G08810

Position : Chr3 ( 5`- 2675631 .. 2676693 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G08810

Protein [Map View]
MSYPERKRKRSRWSKPHSTQNPSPSLPDDVLLSIFARVSRLYYPTLSHVSESFRSLLASPELYKARSLSGNTEICLYVCL
RCSTGYRWFSLSRKPDQTLTYEERKSSGYALARVPIPGGSPNVRSSSLVAVGSDIYNICGSINKASSSSSVSILDCQSHT
WREAPSLPVELSSISASVRDGNQGGHGYSDSRKNSFKVFAYNSKEGRWDHLVGLGAGSFMLPDSYCVIDNVSYSVSDGMF
RWYDTEVRRWKDLRGLFQLPKFSAGACVILADYGGKMAVLWDQLPYHHGFHKTIQCAVIALERRTSFVFREKSCQIWGKV
EWVDDLLTVPTSYDLVKVLVATL*

DNA
ATGTCTTACCCGGAAAGAAAGAGGAAGAGGAGTCGGTGGTCAAAGCCGCATTCGACCCAAAACCCGTCACCGTCACTTCC
CGATGATGTGCTATTGAGCATCTTCGCACGCGTCTCAAGATTGTACTATCCGACTCTCTCACACGTATCCGAGAGCTTTC
GATCTCTCCTAGCTTCACCAGAGCTTTACAAAGCCAGGTCACTCTCGGGAAACACCGAGATCTGTCTCTACGTGTGCTTA
CGGTGCTCTACTGGTTATCGCTGGTTTAGCCTCAGCCGTAAACCTGATCAAACCCTAACCTATGAGGAGAGGAAGTCAAG
TGGTTATGCTTTGGCTAGAGTCCCAATTCCCGGTGGTTCTCCTAATGTACGATCTTCGAGTCTCGTGGCGGTTGGTTCTG
ATATCTATAACATTTGCGGATCCATCAACAAAGCGTCCTCCTCCTCTAGCGTCTCAATTCTGGATTGTCAGTCTCACACG
TGGCGGGAGGCTCCAAGCTTGCCGGTGGAGCTAAGTTCAATTTCTGCTAGCGTCCGTGATGGAAACCAAGGCGGCCATGG
GTATTCTGATTCCCGGAAAAACTCCTTTAAGGTGTTTGCTTACAATTCCAAGGAAGGTAGATGGGATCACCTAGTTGGAC
TTGGGGCGGGTAGTTTTATGCTTCCAGATTCTTATTGCGTGATAGATAACGTTTCGTACTCTGTATCCGATGGAATGTTC
AGATGGTATGACACTGAGGTAAGAAGGTGGAAAGATTTGAGGGGTTTGTTTCAGCTACCTAAGTTCTCTGCGGGTGCTTG
TGTTATATTGGCTGATTATGGTGGAAAGATGGCGGTCTTGTGGGATCAATTGCCTTATCATCATGGCTTTCATAAGACGA
TTCAGTGTGCGGTGATTGCGCTTGAAAGGCGCACAAGTTTTGTATTTCGGGAGAAAAGTTGTCAAATTTGGGGGAAGGTT
GAGTGGGTTGATGATTTACTTACAGTCCCTACATCGTATGATCTTGTGAAGGTTCTTGTTGCTACTCTTTGA