Details for Arabidopsis Locus AT3G08670

Position : Chr3 ( 5`- 2633728 .. 2636715 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G08670

Protein [Map View]
MNRNLRESLAGGRNIPAISQFRRGNNNNSNNISQNGFSRDSDENLDLFSKIRRSFPLASSDELPDVSAKLGRLSVGSKIA
PKGKDDLLSSAEGGKNDYDWLLTPPGTPLGNDSHSSLAAPKIASSARASSASKASRLSVSQSESGYHSSRPARSSSVTRP
SISTSQYSSFTSGRSPSSILNTSSASVSSYIRPSSPSSRSSSSARPSTPTRTSSASRSSTPSRIRPGSSSSSMDKARPSL
SSRPSTPTSRPQLSASSPNIIASRPNSRPSTPTRRSPSSTSLSATSGPTISGGRAASNGRTGPSLSRPSSPGPRVRNTPQ
QPIVLADFPLDTPPNLRTSLPDRPISAGRSRPVGGSSMAKASPEPKGPITRRNSSPIVTRGRLTETQGKGRFGGNGQHLT
DAPEPRRISNVSDITSRRTVKTSTTVTDNNNGLGRSFSKSSLDMAIRHMDIRNGKTNGCALSTTTLFPQSIRPASSKIQP
IRSGNNHSDSISSNGTENGNEANEGRRLMGKLSDMDMYESSRYDALLLKEDVKNTNWLHSIDDRSSDHGLMFDNGGFELL
PEPFAPL*

DNA
ATGAATAGGAATCTCAGAGAATCTCTTGCCGGTGGGAGGAATATTCCGGCGATCTCTCAGTTTCGTAGAGGCAATAACAA
CAACAGCAACAACATCTCTCAAAATGGCTTCTCTAGAGATTCCGATGAGAATCTAGATCTTTTCTCTAAGATCCGTCGCT
CATTTCCTTTGGCTTCCTCCGACGAATTACCCGACGTTTCTGCAAAACTCGGGAGACTCTCGGTCGGATCCAAAATAGCT
CCCAAAGGCAAAGATGATCTCTTGTCTTCAGCTGAAGGAGGAAAAAATGATTATGATTGGCTTCTTACGCCTCCTGGAAC
ACCTCTTGGAAACGACTCTCATTCATCTTTGGCAGCTCCAAAGATTGCATCTTCCGCTAGAGCCAGTTCTGCTTCAAAGG
CTTCAAGGCTTTCAGTTTCGCAGTCAGAGAGCGGTTACCATTCCTCCCGTCCAGCCAGAAGTAGCTCTGTGACTCGCCCA
TCCATTTCCACCTCGCAATACAGCTCATTTACTTCAGGCCGTTCACCATCTTCAATCCTAAACACTAGTTCAGCTTCAGT
CTCATCCTACATCAGACCTTCATCCCCGAGTTCCCGTTCCTCATCTTCAGCTAGACCTTCCACTCCCACCCGTACTTCTT
CCGCATCACGGTCCTCAACTCCATCGAGAATCCGTCCAGGGTCATCTAGTTCATCCATGGACAAGGCTAGACCGTCCCTG
AGCTCAAGACCATCGACTCCAACTTCTAGACCACAACTCTCAGCAAGCTCTCCAAATATAATTGCTTCTAGACCAAATTC
TCGTCCTTCAACCCCTACCCGTCGAAGCCCATCATCCACCTCATTGTCTGCAACATCAGGACCCACTATTTCAGGTGGAC
GTGCTGCATCAAATGGTCGTACTGGACCTTCATTGTCTAGGCCAAGCTCTCCTGGACCTAGAGTTAGAAACACCCCGCAA
CAGCCAATTGTGCTAGCAGACTTCCCTCTTGATACACCACCTAATCTGAGAACATCTCTCCCGGACAGACCAATATCAGC
TGGCAGGTCCAGGCCAGTTGGTGGTAGCAGCATGGCTAAGGCAAGTCCAGAACCCAAAGGTCCCATCACAAGAAGGAATT
CATCTCCTATTGTGACGAGAGGAAGACTCACTGAGACCCAAGGAAAAGGCCGTTTTGGTGGTAATGGGCAGCATCTCACA
GATGCACCAGAGCCCCGAAGGATTTCAAACGTTTCTGACATAACTTCACGGAGAACCGTGAAGACCTCGACAACTGTCAC
GGACAATAACAACGGGCTTGGGAGGTCATTCTCAAAAAGTTCACTCGATATGGCCATTAGACACATGGACATAAGAAATG
GAAAGACTAATGGTTGCGCACTATCAACCACAACGCTATTCCCTCAGAGCATCAGACCAGCCTCATCCAAGATCCAGCCA
ATCCGTTCAGGGAATAATCATTCGGATTCTATCAGCAGCAATGGCACAGAGAACGGGAATGAAGCAAACGAGGGTAGAAG
ACTGATGGGGAAGTTGAGTGACATGGACATGTATGAGAGCTCAAGGTATGATGCATTGTTGCTGAAAGAGGACGTCAAAA
ACACAAACTGGTTACATAGCATCGATGACCGGTCGTCAGATCACGGACTCATGTTTGACAATGGAGGATTCGAGCTACTT
CCAGAGCCATTTGCCCCACTATAA