Details for Arabidopsis Locus AT3G08630

Position : Chr3 ( 5`- 2620832 .. 2622220 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G08630

Protein [Map View]
MAAMAAKLHISTKSDQSNVRLPRLINLSRDPTARVLFPRNGSVSSLHTNFSSPNIMVPCAGGGGGGSIGNHGGGSGSGGG
GGGYGGSEEEESSPWGPLGLFIQGWRSRVAADSQFPFKVLMEMLVGVSANVLGDMASRPNFGLNELDFVFSTLVVGSILN
FTLMYLLAPSAISHGSSNLLPGIFRSCPSSHMFEQGNFTLMNRFGTLVYKGMVFATVGLAAGLVGTAISNGLIMLRKKID
PSFETPNKPPPTLLNSLTWATHMGVSANVRYQTLNGAEFLLEKSLPPLVFKTSVIALRVVNNVLGGMSFVTLARMTGSQS
VEEEKKIEMSEISEKEKED*

DNA
ATGGCGGCTATGGCGGCGAAGCTTCATATATCGACGAAATCGGATCAGAGCAATGTGCGATTGCCTAGACTGATCAACCT
GTCGCGTGATCCAACCGCTAGAGTCTTGTTTCCACGAAACGGATCAGTTTCTTCGCTCCACACCAACTTCTCTTCTCCAA
ATATAATGGTTCCATGCGCCGGAGGTGGTGGTGGTGGAAGCATCGGTAATCACGGCGGTGGAAGTGGAAGCGGAGGAGGT
GGTGGTGGTTATGGAGGTTCAGAAGAAGAAGAATCGTCTCCATGGGGACCATTAGGGTTATTTATCCAAGGATGGAGATC
ACGAGTTGCAGCTGATTCTCAATTCCCTTTCAAGGTACTAATGGAAATGCTTGTTGGTGTTAGCGCCAATGTACTTGGCG
ACATGGCTTCACGCCCTAATTTCGGATTGAACGAGCTAGATTTCGTCTTCTCCACTCTCGTTGTAGGTTCGATTCTCAAT
TTCACACTCATGTACCTCTTAGCTCCTTCTGCAATATCTCATGGATCCTCCAATTTGTTGCCTGGAATCTTTAGAAGCTG
TCCTTCGAGCCATATGTTTGAACAGGGTAACTTCACCCTTATGAACCGTTTTGGGACTCTTGTGTACAAAGGAATGGTTT
TTGCTACCGTGGGATTAGCTGCAGGTCTTGTTGGAACCGCTATCTCTAACGGGTTGATCATGCTGAGGAAAAAGATTGAT
CCGAGCTTCGAAACGCCGAACAAACCACCACCTACGCTGCTGAATTCTTTAACTTGGGCAACGCATATGGGAGTGAGCGC
CAATGTGAGGTACCAAACGTTGAATGGGGCTGAATTCTTGCTGGAAAAGTCATTGCCGCCATTGGTGTTTAAAACAAGTG
TGATTGCTTTGAGGGTTGTGAACAATGTTTTGGGAGGAATGTCGTTTGTTACATTGGCGAGGATGACTGGATCACAGTCG
GTGGAGGAGGAGAAGAAGATAGAGATGTCAGAGATATCAGAGAAGGAGAAAGAGGATTGA