Details for Arabidopsis Locus AT3G08610

Position : Chr3 ( 5`- 2615426 .. 2616803 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G08610

Protein [Map View]
MSLVWLEAMLPLGIIGGMLCIMGNSQYYIHKAYHGRPKHIGHDEWDVAMERRDKKVVEKAAAPSS*

DNA
ATGTCGTTGGTATGGTTGGAAGCGATGTTGCCTCTCGGAATCATCGGTGGGATGCTCTGTATCATGGGCAATTCTCAGTA
CTACATCCACAAAGCTTATCATGGCCGTCCTAAGCACATCGGCCACGATGAATGGGATGTTGCTATGGAAAGACGCGACA
AGAAAGTCGTCGAGAAAGCTGCAGCTCCTTCCTCATGA