Details for Arabidopsis Locus AT3G08590

Position : Chr3 ( 5`- 2608471 .. 2611418 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G08590

Protein [Map View]
MGSSGDVNWKLADHPKLPKGKTIGLIVLDGWGESDPDQYNCIHKAPTPAMDSLKDGKPDTWRLIKAHGTAVGLPSEDDMG
NSEVGHNALGAGRIYAQGAKLVDLALASGKIYEDEGFKYISQSFEKGTVHLIGLLSDGGVHSRLDQVQLLLKGFAERGAK
RIRVHILTDGRDVLDGSSVGFVETLEADLAALRAKGVDAQVASGGGRMYVTMDRYENDWSVVKRGWDAQVLGEAPHKFKS
ALEAVKTLRAEPGANDQYLPSFVIVDDNGKAVGPIVDGDAVVTFNFRADRMVMHAKALEYKDFDKFDRVRVPDIRYAGML
QYDGELKLPSRYLVSPPLIDRTSGEYLAHNGVRTFACSETVKFGHVTFFWNGNRSGYFNEKLEEYVEIPSDSGISFNVQP
KMKALEIAEKARDAILSGKFDQVRVNLPNGDMVGHTGDIEATVVACEAADRAVRTILDAIEQVGGIYVVTADHGNAEDMV
KRDKSGKPALDKEGNLQILTSHTLKPVPIAIGGPGLSAGVRFRQDIETPGLANVAATVMNLHGFVAPSDYETSLIEVVEK
*

DNA
ATGGGTAGCTCCGGCGACGTTAACTGGAAACTTGCGGACCACCCCAAGCTTCCCAAAGGCAAAACTATCGGTTTGATTGT
TCTCGATGGATGGGGTGAATCTGATCCCGATCAATACAATTGCATCCATAAAGCTCCAACTCCTGCCATGGATTCCCTTA
AAGACGGGAAGCCCGACACATGGAGGTTGATCAAAGCTCATGGTACCGCCGTTGGTCTCCCCAGCGAAGACGACATGGGA
AACAGTGAAGTTGGCCACAATGCTCTTGGAGCTGGTCGAATTTACGCTCAAGGTGCTAAGCTTGTTGATCTCGCCCTTGC
TTCAGGGAAAATCTATGAAGATGAAGGTTTCAAATACATCTCTCAATCTTTTGAGAAAGGCACTGTGCACCTTATTGGTC
TTCTAAGCGATGGTGGAGTTCACTCTCGTTTGGATCAAGTCCAGTTGCTGCTTAAGGGTTTTGCAGAACGTGGTGCTAAG
AGAATCCGCGTCCATATTCTTACTGATGGTCGTGATGTTTTGGATGGTTCTAGTGTCGGATTTGTTGAAACTCTTGAAGC
TGACCTAGCTGCTTTACGTGCGAAAGGTGTTGATGCTCAGGTTGCATCTGGTGGAGGTCGAATGTATGTCACAATGGACC
GTTATGAGAATGATTGGAGTGTTGTTAAACGAGGTTGGGATGCACAAGTCCTTGGGGAAGCTCCCCACAAATTTAAAAGC
GCTCTTGAAGCAGTTAAGACACTGAGGGCAGAACCTGGTGCCAATGACCAGTATTTGCCTTCGTTTGTTATTGTTGATGA
TAATGGAAAGGCTGTGGGTCCAATTGTTGATGGTGACGCAGTTGTTACATTCAATTTCCGTGCTGATCGAATGGTCATGC
ATGCAAAGGCCCTCGAATACAAAGATTTCGACAAGTTTGATCGCGTACGTGTCCCTGATATACGTTATGCAGGAATGCTC
CAATATGATGGAGAGCTTAAGCTTCCTAGCCGCTATCTTGTTTCTCCACCATTGATTGACAGAACTTCTGGTGAATATCT
GGCACACAATGGCGTTCGTACTTTTGCTTGCAGTGAGACTGTGAAGTTTGGCCATGTAACCTTCTTCTGGAATGGCAACC
GCTCTGGATATTTCAATGAAAAGTTAGAAGAGTACGTTGAGATTCCAAGTGATAGTGGAATATCATTCAATGTCCAGCCA
AAGATGAAAGCACTGGAAATTGCCGAGAAAGCAAGGGATGCTATCCTTAGTGGCAAGTTTGACCAGGTGCGTGTAAACCT
GCCAAATGGAGATATGGTGGGGCATACTGGTGATATTGAAGCAACTGTTGTTGCCTGTGAAGCTGCTGATCGTGCTGTGA
GGACAATCCTTGATGCCATAGAACAGGTCGGAGGGATATACGTTGTGACTGCAGATCACGGAAATGCTGAGGACATGGTT
AAAAGGGACAAATCCGGCAAGCCTGCTCTCGATAAGGAAGGGAACCTTCAGATTCTTACCTCTCACACCCTTAAACCAGT
GCCAATTGCCATAGGAGGTCCTGGCTTGTCAGCAGGAGTTAGGTTTAGACAGGATATCGAGACACCTGGGCTTGCAAATG
TAGCTGCGACAGTGATGAACCTCCATGGATTTGTGGCCCCGAGTGACTATGAGACAAGTCTGATCGAAGTCGTCGAGAAG
TGA