Details for Arabidopsis Locus AT3G08530

Position : Chr3 ( 5`- 2586806 .. 2595572 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G08530

Protein [Map View]
MAAANAPITMKEVLTLPSIGINQQFITFTNVTMESDKYICVRETSPQNSVVIIDMNMPMQPLRRPITADSALMNPNSKIL
ALKAQVPGTTQDHLQIFNIEAKAKLKSHQMPEQVVFWKWITPKMLGLVTQNSVYHWSIEGDSEPVKMFDRTANLANNQII
NYKCSPNEKWLVLIGIAPGSPERQQLVKGNMQLFSVDQQRSQALEAHAASFAQFKVPGNENPSILISFASKSFNAGQITS
KLHVIELGAQPGKPSFTKKQADLFFPPDFADDFPVAMQVSHKFNLIYVITKLGLLFVYDLETASAIYRNRISPDPIFLTS
EASSVGGFYAINRRGQVLLATVNEATIIPFISGQLNNLELAVNLAKRGNLPGAENLVVQRFQELFAQTKYKEAAELAAES
PQGILRTPDTVAKFQSVPVQAGQTPPLLQYFGTLLTRGKLNSYESLELSRLVVNQNKKNLLENWLAEDKLECSEELGDLV
KTVDNDLALKIYIKARATPKVVAAFAERREFDKILIYSKQVGYTPDYLFLLQTILRTDPQGAVNFALMMSQMEGGSPVDY
NTITDLFLQRNLIREATSFLLDVLKPNLPEHAFLQTKVLEINLVTFPNVADAVLANGMFTHYDRPRIAQLCEKAGLYIQS
LKHYSELPDIKRVIVNTHAIEPQALVEFFGTLSSEWAMECMKDLLLVNLRGNLQIIVQACKEYCEQLGVDACIKLFEQFK
SYEGLYFFLGSYLSMSEDPEIHFKYIEAAAKTGQIKEVERVTRESNFYDAEKTKNFLMEAKLPDARPLINVCDRFSFVPD
LTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPEDFIKGLILSVRSLLPVEPLVEECEKRNRLRLLTQFLEHLV
SEGSQDVHVHNALGKIIIDSNNNPEHFLTTNPYYDSKVVGKYCEKRDPTLAVVAYRRGQCDEELINVTNKNSLFKLQARY
VVERMDGDLWDKVLDENNDYRRQLIDQVVSTALPESKSPEQVSAAVKAFMTADLPHELIELLEKIVLQNSAFSGNFNLQN
LLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLYEEAFAIFKKFNLNVQAVNVLLDNVRSIERAVEFAFRVEEDS
VWSQVAKAQLREGLVSDAIESFIRADDATHFLEVIRVSEDTDVYDDLVKYLLMVRQKVKEPKVDSELIYAYAKIDRLGEI
EEFILMPNVANLQHVGDRLYDEALYEAAKIIYAFISNWGKLAVTLVKLQQFQGAVDAARKANSAKTWKEVCFACVDAEEF
RLAQICGLNIIIQVDDLEEVSEYYQNRGCFNELISLMESGLGLERAHMGIFTELGVLYARYRYEKLMEHIKLFSTRLNIP
KLIRACDEQQHWQELTYLYIQYDEFDNAATTVMNHSPEAWEHMQFKDIVAKVANVELYYKAVHFYLQEHPDIINDLLNVL
ALRLDHTRVVDIMRKAGHLRLIKPYMIAVQSNNVSAVNEALNEIYVEEEDYDRLRESIDLHDSFDQIGLAQKIEKHELVE
MRRVAAYIYKKAGRWKQSIALSKKDNMYKDCMETASQSGEHELAEQLLVYFIEQGKKECFATCLFVCYDLIRPDVALELA
WINNMMDFAFPYLLQFIREYSGKVDELIKDKLEAQKEVKAKEQEEKDVISQQNMYAQMLPLALPAPPMPGMGGGGGYGPP
PQMGGMPGMPPMPPYGMPPMGGY*

DNA
ATGGCGGCTGCCAACGCCCCCATCACGATGAAGGAGGTCCTGACGCTTCCGAGCATCGGGATCAATCAGCAATTCATCAC
GTTTACAAATGTTACTATGGAGTCTGACAAGTATATCTGTGTACGAGAGACGTCACCGCAAAACAGTGTTGTAATTATAG
ATATGAATATGCCGATGCAGCCTCTTAGGAGGCCTATTACTGCAGACTCTGCTCTTATGAACCCAAACTCGAAGATCCTT
GCCTTGAAAGCTCAAGTTCCAGGAACTACTCAGGATCATCTACAGATATTTAACATTGAAGCCAAAGCAAAGTTGAAATC
ACATCAGATGCCTGAGCAGGTTGTCTTTTGGAAGTGGATTACACCAAAGATGTTGGGGCTGGTCACACAGAATTCCGTCT
ATCATTGGTCAATTGAAGGTGATTCTGAGCCAGTTAAGATGTTTGATAGAACAGCCAATTTGGCCAACAATCAAATTATA
AACTATAAGTGCTCTCCTAATGAGAAGTGGTTGGTTTTAATTGGAATTGCTCCTGGCTCTCCTGAGAGACAACAATTGGT
AAAAGGAAATATGCAGCTTTTCTCTGTGGATCAACAGCGGAGTCAGGCCCTTGAGGCACATGCTGCATCGTTTGCGCAGT
TTAAGGTTCCTGGGAATGAGAATCCTTCTATTCTTATATCATTTGCAAGCAAGAGCTTTAATGCTGGGCAGATAACATCA
AAGTTGCATGTCATTGAGCTTGGTGCCCAACCTGGAAAACCATCATTTACAAAAAAACAAGCAGATCTCTTTTTTCCCCC
TGATTTTGCTGATGATTTTCCTGTTGCCATGCAGGTCTCTCACAAATTTAACTTGATATATGTTATCACCAAACTTGGCC
TGTTGTTTGTGTACGATCTAGAGACTGCTTCTGCTATCTACAGAAATCGGATTAGTCCAGACCCAATTTTCTTGACTTCT
GAAGCTTCCTCAGTTGGGGGTTTCTATGCCATTAATAGGCGAGGACAAGTTCTTTTGGCTACAGTAAACGAGGCTACCAT
TATACCTTTTATTAGTGGCCAATTGAACAATTTGGAGCTTGCTGTCAATCTTGCTAAAAGAGGAAACCTCCCAGGTGCAG
AAAATCTGGTTGTCCAGCGGTTCCAGGAGTTGTTCGCTCAAACAAAGTACAAGGAGGCTGCTGAGCTTGCTGCTGAATCT
CCTCAAGGAATTCTAAGGACACCTGATACAGTGGCCAAATTCCAGAGTGTTCCTGTACAAGCTGGACAAACTCCTCCATT
GTTACAGTATTTTGGGACTCTTTTGACTAGAGGGAAACTCAATTCATATGAGTCACTGGAACTATCTCGGCTGGTTGTGA
ACCAAAACAAGAAGAACCTCCTGGAAAACTGGTTGGCAGAGGATAAACTAGAATGCAGTGAAGAACTTGGAGACCTTGTG
AAGACTGTGGATAATGATCTCGCTCTGAAAATATACATCAAAGCTCGGGCGACTCCAAAAGTTGTAGCAGCTTTTGCAGA
AAGAAGGGAGTTTGACAAAATACTGATTTACTCAAAGCAGGTTGGGTACACACCTGATTACCTGTTTCTTCTGCAAACCA
TACTCCGTACAGATCCTCAGGGAGCAGTAAATTTTGCATTAATGATGTCTCAAATGGAAGGAGGTTCTCCAGTTGACTAC
AACACCATCACTGATCTTTTTCTTCAGAGAAATCTGATCCGTGAAGCGACTTCTTTCCTTCTGGATGTGCTAAAGCCAAA
TTTACCTGAGCATGCTTTTCTGCAAACTAAGGTTCTGGAGATAAATTTGGTAACTTTTCCTAATGTGGCTGATGCGGTAT
TAGCAAATGGGATGTTCACCCACTATGACCGGCCTCGCATTGCTCAACTTTGTGAAAAGGCTGGACTTTATATCCAATCC
TTGAAGCATTACTCAGAGTTACCTGATATAAAACGTGTAATTGTAAACACACATGCTATCGAGCCACAGGCTCTTGTTGA
GTTTTTTGGCACTCTTTCTAGCGAGTGGGCTATGGAGTGCATGAAGGATCTGTTGCTGGTCAACCTGAGAGGCAATCTGC
AGATAATTGTTCAGGCTTGCAAGGAGTACTGTGAGCAACTTGGTGTTGATGCATGTATTAAGCTCTTTGAGCAGTTCAAG
TCATATGAAGGGCTATACTTTTTCCTAGGTTCATATTTGAGTATGAGTGAGGATCCTGAGATCCATTTCAAGTACATTGA
AGCAGCTGCCAAGACTGGTCAAATAAAGGAGGTTGAGCGTGTAACTAGAGAGTCTAACTTCTATGATGCTGAAAAGACGA
AGAACTTTTTGATGGAAGCTAAGCTGCCTGATGCACGACCTTTGATAAATGTCTGTGATCGTTTCAGCTTTGTGCCTGAT
CTTACTCATTACCTCTACACAAACAACATGCTTCGTTACATTGAAGGCTACGTGCAGAAGGTGAACCCTGGGAATGCTCC
CTTAGTTGTCGGGCAGTTGCTTGATGATGAATGCCCTGAAGATTTTATAAAAGGCCTCATTCTCTCTGTTCGTTCATTGC
TTCCTGTTGAACCACTTGTCGAGGAATGTGAGAAGAGAAATCGACTCCGTCTCCTCACTCAGTTCTTGGAGCATTTAGTT
AGTGAGGGAAGCCAAGATGTGCATGTCCATAATGCCTTGGGTAAAATTATCATAGACAGTAACAACAACCCTGAGCATTT
CCTGACCACCAACCCTTACTACGACTCTAAGGTTGTGGGTAAGTACTGCGAGAAACGTGATCCTACCCTAGCAGTTGTGG
CATACAGAAGAGGACAATGTGACGAGGAACTCATCAATGTCACTAACAAAAACTCTTTGTTTAAGTTACAAGCCAGGTAT
GTAGTGGAGAGGATGGATGGTGATCTGTGGGATAAGGTTCTCGATGAAAACAATGATTATAGAAGACAGCTTATTGACCA
AGTTGTGTCTACTGCTTTACCTGAAAGCAAGAGCCCAGAGCAAGTTTCTGCAGCTGTTAAAGCATTCATGACTGCTGATT
TGCCGCACGAGCTTATTGAGCTTCTTGAAAAGATTGTTCTACAAAATTCTGCCTTCAGTGGAAACTTCAATCTGCAAAAT
CTGCTTATATTGACAGCTATTAAGGCAGATCCGTCTAGAGTTATGGATTACATCAACAGGCTGGACAACTTTGATGGACC
TGCAGTTGGAGAAGTCGCAGTTGAAGCCCAATTATATGAGGAAGCATTTGCTATCTTCAAGAAGTTCAACTTAAATGTTC
AGGCTGTCAATGTATTGCTGGATAATGTCAGGAGCATTGAGCGTGCAGTTGAGTTTGCATTCCGGGTCGAAGAAGATTCT
GTTTGGAGCCAAGTCGCTAAGGCGCAACTCAGGGAAGGACTAGTCAGTGATGCAATTGAGTCCTTTATCCGTGCTGATGA
TGCCACTCATTTCTTGGAGGTCATACGTGTCTCTGAAGATACTGATGTCTATGATGACTTGGTCAAATACCTTCTGATGG
TTAGACAGAAGGTGAAGGAACCCAAGGTTGATAGTGAGCTCATCTATGCATATGCAAAGATTGATCGGTTAGGTGAGATT
GAAGAATTCATTCTGATGCCAAACGTTGCTAATCTACAACATGTTGGTGATCGTCTGTATGACGAAGCTCTCTATGAGGC
TGCAAAAATAATCTATGCGTTCATATCAAACTGGGGCAAGTTAGCCGTCACACTTGTGAAGTTGCAACAGTTCCAAGGTG
CTGTTGATGCTGCAAGGAAAGCAAACAGTGCAAAGACATGGAAGGAAGTCTGCTTTGCTTGCGTTGATGCTGAGGAATTC
CGGTTGGCTCAAATATGTGGTCTTAACATTATCATTCAGGTGGATGACCTGGAAGAAGTCAGCGAGTACTACCAGAACAG
AGGGTGCTTCAATGAATTAATCTCACTTATGGAGAGTGGACTTGGGCTTGAACGTGCTCACATGGGTATCTTCACCGAGT
TGGGTGTACTCTATGCTAGATATCGTTATGAGAAACTTATGGAACACATCAAGTTATTTTCAACTCGCCTCAATATTCCC
AAGCTTATACGGGCCTGTGATGAACAACAGCACTGGCAGGAACTTACCTATCTGTACATTCAATATGATGAGTTTGATAA
TGCTGCGACCACCGTCATGAACCATTCTCCTGAAGCATGGGAGCACATGCAATTCAAAGACATTGTTGCCAAGGTAGCGA
ATGTTGAACTGTACTACAAGGCTGTGCACTTCTACTTGCAAGAGCATCCGGATATAATCAACGATCTTCTCAACGTACTT
GCGTTGCGGTTAGACCATACTCGTGTTGTTGATATAATGCGGAAGGCTGGTCACTTGCGTCTTATCAAGCCATACATGAT
TGCAGTTCAGAGCAACAATGTCTCTGCTGTTAATGAGGCTCTGAATGAGATATACGTGGAAGAAGAAGACTACGATAGGT
TGCGAGAGTCTATTGATTTACATGACAGCTTTGACCAGATTGGCCTCGCTCAGAAGATCGAGAAACACGAACTTGTTGAA
ATGAGACGTGTGGCTGCTTATATCTACAAGAAAGCGGGCAGATGGAAGCAATCAATTGCATTATCAAAGAAAGACAACAT
GTACAAGGACTGTATGGAAACGGCTTCACAATCAGGCGAACATGAACTTGCAGAACAACTACTGGTGTATTTCATTGAAC
AGGGCAAAAAGGAATGCTTTGCTACATGTCTCTTTGTATGTTATGACTTAATCCGACCAGACGTGGCTCTAGAACTTGCC
TGGATCAACAATATGATGGACTTTGCCTTCCCGTATCTCCTCCAGTTTATCCGAGAGTACTCTGGCAAAGTGGATGAGCT
AATAAAGGACAAGCTTGAGGCACAAAAAGAGGTGAAGGCCAAAGAGCAGGAAGAGAAGGATGTCATATCCCAACAGAACA
TGTATGCCCAAATGTTGCCACTTGCTTTACCTGCACCACCGATGCCAGGAATGGGAGGTGGTGGTGGGTATGGTCCTCCA
CCACAAATGGGCGGTATGCCAGGAATGCCTCCCATGCCACCATATGGAATGCCACCGATGGGCGGCTACTAA