Details for Arabidopsis Locus AT3G08505

Position : Chr3 ( 5`- 2580077 .. 2582129 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G08505

Protein [Map View]
MSDRILCKFFVHGSCLKGENCEFSHDSKDPPNNVCTFYQKRICLYGSRCRYDHVRAASNLPLSSDSESLDRSISTTPSRH
LQQQGDNNDGDKSSNVYCIHPREYPICSFAAAGDCPRGNQCPHMHGDLCNTCGKKCLHPFRPEEREEHTKECEKKQKHIE
ALKQSQDIECSVCLDRILSKATPGERKFGLLTECDHPFCIQCIRNWRSSAPVSGMDVNSTLRACPICRKLSYFVVPSVVW
YSSPEEKKEIIDIYKAKLRSIDCKHFNFGNGNCPFGASCFYKHAYSDGHLEEVVLRHLGSQEGETVITDSIRLSEFLGGL
QIF*

DNA
ATGTCCGATAGGATACTGTGCAAGTTCTTTGTCCATGGCTCGTGCTTGAAAGGCGAAAATTGCGAATTTTCCCATGACTC
TAAGGATCCGCCCAATAATGTTTGCACATTCTATCAGAAACGAATATGTTTGTACGGAAGTAGATGTAGATACGATCATG
TCAGAGCTGCTTCCAATCTTCCTCTTAGCTCAGATTCTGAGTCTTTAGATCGCTCTATATCCACCACCCCCTCTAGGCAT
TTGCAACAACAAGGCGATAATAATGACGGTGACAAATCCTCTAACGTTTACTGTATCCACCCTAGAGAGTACCCGATCTG
CTCTTTTGCTGCAGCTGGTGATTGCCCTCGAGGTAACCAGTGTCCACATATGCATGGTGACCTCTGCAATACTTGTGGCA
AGAAGTGTTTGCATCCTTTTAGACCCGAGGAACGAGAAGAGCATACGAAAGAATGTGAGAAGAAGCAGAAGCACATTGAG
GCTTTGAAACAAAGTCAAGATATTGAGTGTAGTGTGTGTTTGGATCGTATCTTGTCAAAGGCTACTCCAGGGGAAAGGAA
GTTTGGGCTGTTGACTGAGTGTGATCATCCGTTTTGTATACAATGTATTCGTAATTGGCGTAGCAGTGCTCCTGTTTCGG
GAATGGATGTCAACAGTACGTTGAGAGCTTGTCCTATATGTCGCAAACTCTCTTATTTTGTTGTCCCTAGTGTGGTCTGG
TACTCTTCTCCTGAGGAGAAGAAGGAAATTATCGACATATACAAGGCTAAACTCAGATCAATCGACTGTAAGCACTTCAA
CTTTGGAAATGGAAACTGCCCATTTGGAGCAAGTTGTTTCTATAAGCATGCATATTCTGATGGTCACTTGGAAGAGGTTG
TTTTACGGCATCTTGGTTCTCAAGAAGGAGAAACTGTAATAACAGACAGTATCAGGCTATCAGAGTTCCTTGGTGGCCTG
CAGATTTTCTAA